OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZKSCAN3 (NM_024493) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202971
ZKSCAN3 (Myc-DDK-tagged)-Human zinc finger with KRAB and SCAN domains 3 (ZKSCAN3)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $501.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA308508 Rabbit Polyclonal antibody to ZKSCAN3 (zinc finger with KRAB and SCAN domains 3)
100 ul
$665.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "ZKSCAN3 or NM_024493"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ZKSCAN3
Synonyms dJ874C20.1; dJ874C20.1.; ZF47; zfp-47; Zfp47; ZFP306; ZNF306; ZNF309; ZSCAN13; ZSCAN35
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202971 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTAGAGAATTAAGTGAAAGCACAGCCCTGGATGCCCAGTCTACAGAAGACCAGATGGAGCTTCTGG
TCATAAAGGTGGAGGAAGAAGAAGCCGGTTTTCCCAGTAGCCCAGATCTGGGTTCTGAGGGCTCCCGCGA
GCGCTTCCGAGGCTTCCGCTACCCGGAGGCTGCAGGCCCCCGCGAGGCGCTGAGTCGGCTCCGAGAGCTC
TGCCGACAGTGGCTGCAGCCTGAGATGCACAGCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGT
TCCTGACCATCCTGCCGGGGAATCTGCAGAGCTGGGTGCGGGAGCAGCATCCAGAGAGCGGGGAGGAGGT
GGTGGTGCTATTGGAGTATTTGGAGAGGCAGCTGGATGAGCCGGCGCCGCAGGTTTCAGGTGTTGACCAG
GGGCAAGAACTGCTCTGTTGCAAGATGGCACTATTGACACCAGCCCCAGGGTCACAAAGTAGCCAATTTC
AGCTAATGAAGGCTCTGCTCAAGCATGAATCTGTGGGATCCCAGCCTTTACAAGATAGAGTTCTCCAGGT
CCCCATGCTTGCCCATGGAGGATGCTGCAGAGAAGATGCAGTGGTAGCTTCTAGGCTTACTCCAGAGTCC
CAGGGGTTGTTGAAAGTGGAAGATGTGGCCCTGACCCTCACCCCTGAATGGACACAGCAGGATTCATCTC
AGGGGAATCTCTGTAGAGATGAAAAGCAGGAGAACCATGGCAGCCTGGTCTCCCTGGGTGATGAAAAACA
GACTAAGAGCAGGGACTTGCCTCCAGCTGAGGAGCTTCCAGAAAAGGAGCATGGGAAGATATCGTGCCAC
CTGAGAGAAGACATTGCCCAGATTCCTACATGTGCAGAAGCTGGTGAACAGGAGGGCAGGCTACAAAGAA
AGCAGAAAAATGCCACAGGAGGGAGGCGGCACATCTGCCATGAATGTGGAAAGAGTTTTGCTCAAAGCTC
AGGCCTGAGTAAACACAGGAGAATCCACACTGGTGAGAAACCCTACGAATGTGAAGAGTGTGGCAAAGCC
TTCATTGGGAGCTCTGCCCTTGTCATTCATCAGAGAGTCCACACTGGTGAGAAGCCATATGAGTGTGAAG
AATGTGGTAAGGCCTTCAGTCATAGCTCAGACCTTATCAAGCATCAGAGAACCCACACTGGGGAGAAGCC
CTATGAGTGTGATGACTGTGGGAAGACCTTCAGCCAGAGCTGCAGCCTCCTTGAACATCACAGAATCCAC
ACTGGGGAGAAGCCGTATCAGTGCAGTATGTGTGGCAAAGCCTTTAGGCGAAGTTCACATCTCCTGAGAC
ATCAGAGGATCCATACTGGGGATAAAAATGTTCAGGAACCTGAGCAGGGAGAGGCCTGGAAAAGTAGGAT
GGAAAGCCAGTTGGAAAATGTTGAAACTCCCATGTCTTATAAATGTAATGAGTGTGAAAGAAGTTTCACT
CAGAATACAGGCCTCATTGAACATCAAAAAATCCACACTGGTGAGAAACCCTATCAGTGTAATGCGTGTG
GAAAAGGCTTCACCCGAATTTCATACCTTGTTCAACATCAGAGAAGCCATGTAGGGAAAAACATCCTATC
ACAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202971 protein sequence
Red=Cloning site Green=Tags(s)

MARELSESTALDAQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGSRERFRGFRYPEAAGPREALSRLREL
CRQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPESGEEVVVLLEYLERQLDEPAPQVSGVDQ
GQELLCCKMALLTPAPGSQSSQFQLMKALLKHESVGSQPLQDRVLQVPMLAHGGCCREDAVVASRLTPES
QGLLKVEDVALTLTPEWTQQDSSQGNLCRDEKQENHGSLVSLGDEKQTKSRDLPPAEELPEKEHGKISCH
LREDIAQIPTCAEAGEQEGRLQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKA
FIGSSALVIHQRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHRIH
TGEKPYQCSMCGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERSFT
QNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNILSQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_024493
ORF Size 1614 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024493.1, NP_077819.1
RefSeq Size 4725 bp
RefSeq ORF 1617 bp
Locus ID 80317
UniProt ID Q9BRR0
Cytogenetics 6p22.1
Domains KRAB, LER, zf-C2H2
Protein Families Transcription Factors
MW 60.6 kDa
Summary Transcriptional factor that binds to the consensus sequence 5'-GTAGAGTGGGG-3' and acts as a repressor of autophagy. Specifically represses expression of genes involved in autophagy and lysosome biogenesis/function such as MAP1LC3B, ULK1 or WIPI2. Associates with chromatin at the ITGB4 and VEGF promoters. Also acts as a transcription activator and promotes cancer cell progression and/or migration in various tumors and myelomas.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_024493" in other vectors (6)
SKU Description Size Price
RC202971L1 Lenti ORF clone of Human zinc finger with KRAB and SCAN domains 3 (ZKSCAN3), Myc-DDK-tagged 10 ug
$801.00
RC202971L2 Lenti ORF clone of Human zinc finger with KRAB and SCAN domains 3 (ZKSCAN3), mGFP tagged 10 ug
$801.00
RC202971L3 Lenti ORF clone of Human zinc finger with KRAB and SCAN domains 3 (ZKSCAN3), Myc-DDK-tagged 10 ug
$801.00
RC202971L4 Lenti ORF clone of Human zinc finger with KRAB and SCAN domains 3 (ZKSCAN3), mGFP tagged 10 ug
$801.00
RG202971 ZKSCAN3 (tGFP-tagged) - Human zinc finger with KRAB and SCAN domains 3 (ZKSCAN3) 10 ug
$489.00 $701.00
SC319168 ZKSCAN3 (untagged)-Human zinc finger with KRAB and SCAN domains 3 (ZKSCAN3) 10 ug
$502.00

Plasmid Map for RC202971

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202971
Circular map for RC202971

file-alt Citations

Expression of ZKSCAN3 protein suppresses proliferation, migration, and invasion of pancreatic cancer through autophagy
Nonoyama, Matsuo, Sugita et al
Cancer Sci (2024)
Cited by 7
AI Summary: OriGene products contributed to this study by providing the ZKSCAN3 expression construct (RC202971) and the empty vector (PS100001), which were used to manipulate ZKSCAN3 levels in pancreatic cancer cell lines to investigate its role in autophagy and cancer progression.
Snippet: nology, Inc.) at the concentrations stated below: Specifically, PANC-1 was treated at 5 μg/mL, MIA PaCa-2 at 1 μg/mL, and SW 1990 at 1 μg/mL. Conversely, the ZKSCAN3 expression construct (RC202971;OriGene Technologies, Inc.) or empty vector (PS100001;OriGene Technologies, Inc.) was transfected into the pancreatic cancer cell line BxPC-3 using jetOPTIMUS (Funakoshi Co., Ltd.)
ZKSCAN3 promotes bladder cancer cell proliferation, migration, and invasion
Kawahara, Inoue, Ide et al
Oncotarget (2016) 7 (33), 53599-53610 DOI: 10.18632/oncotarget.10679
Snippet: In addition, a ZKSCAN3-siRNA (#4392420;Ambion) and a ZKSCAN3 construct (RC202971;OriGene) were transiently transfected into UMUC3/647V and 5637 cells, respectively
FigureFigureFigure
IHC
ZKSCAN3 Facilitates Liver Metastasis of Colorectal Cancer Associated with CEA-expressing Tumor
Kim, Roh, Tak et al
Anticancer Res. (2016) 36 (5), 2397-406
AI Summary: OriGene’s ZKSCAN3 antibody was used in this study to detect and analyze ZKSCAN3 protein expression, enabling the authors to investigate its role in promoting liver metastasis of colorectal cancer.
Snippet: The following antibodies were used: ZKSCAN3 (OriGene Technologies, Rockville, MD, USA), VEGF (Cell Signaling Technology, Danvers, MA, USA), cyclin D2 (Cell Signaling Technology), AKT (Cell Signaling Technology), phospho-AKT (S473;Cell Signaling Technology ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products