OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Nck (NCK1) (NM_006153) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202869
NCK1 (Myc-DDK-tagged)-Human NCK adaptor protein 1 (NCK1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA324086 Anti-NCK1 Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Nck or NM_006153"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Nck
Synonyms NCK; nck-1; NCKalpha
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202869 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAAGAAGTGGTGGTAGTAGCCAAATTTGATTATGTGGCCCAACAAGAACAAGAGTTGGACATCA
AGAAGAATGAGAGATTATGGCTTCTGGATGATTCTAAGTCCTGGTGGCGAGTTCGAAATTCCATGAATAA
AACAGGTTTTGTGCCTTCTAACTATGTGGAAAGGAAAAACAGTGCTCGGAAAGCATCTATTGTGAAAAAC
CTAAAGGATACCTTAGGCATTGGAAAAGTGAAAAGAAAACCTAGTGTGCCAGATTCTGCATCTCCTGCTG
ATGATAGTTTTGTTGACCCAGGGGAACGTCTCTATGACCTCAACATGCCCGCTTATGTGAAATTTAACTA
CATGGCTGAGAGAGAGGATGAATTATCATTGATAAAGGGGACAAAGGTGATCGTCATGGAGAAATGCAGT
GATGGGTGGTGGCGTGGTAGCTACAATGGACAAGTTGGATGGTTCCCTTCAAACTATGTAACTGAAGAAG
GTGACAGTCCTTTGGGTGACCATGTGGGTTCTCTGTCAGAGAAATTAGCAGCAGTCGTCAATAACCTAAA
TACTGGGCAAGTGTTGCATGTGGTACAGGCTCTTTACCCATTCAGCTCATCTAATGATGAAGAACTTAAT
TTCGAGAAAGGAGATGTAATGGATGTTATTGAAAAACCTGAAAATGACCCAGAGTGGTGGAAATGCAGGA
AGATCAATGGTATGGTTGGTCTAGTACCAAAAAACTATGTTACCGTTATGCAGAATAATCCATTAACTTC
AGGTTTGGAACCATCACCTCCACAGTGTGATTACATTAGGCCTTCACTCACTGGAAAGTTTGCTGGCAAT
CCTTGGTATTATGGCAAAGTCACCAGGCATCAAGCAGAAATGGCATTAAATGAAAGAGGACATGAAGGGG
ATTTCCTCATTCGTGATAGTGAATCTTCGCCAAATGATTTCTCAGTATCACTAAAAGCACAAGGGAAAAA
CAAGCATTTTAAAGTCCAACTAAAAGAGACTGTCTACTGCATTGGGCAGCGTAAATTCAGCACCATGGAA
GAACTTGTAGAACATTACAAAAAGGCACCAATTTTTACAAGTGAACAAGGAGAAAAATTATATCTTGTCA
AGCATTTATCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202869 protein sequence
Red=Cloning site Green=Tags(s)

MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKN
LKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCS
DGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELN
FEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGN
PWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTME
ELVEHYKKAPIFTSEQGEKLYLVKHLS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006153
ORF Size 1131 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006153.6
RefSeq Size 4421 bp
RefSeq ORF 1134 bp
Locus ID 4690
UniProt ID P16333, A0A0S2Z4Y3
Cytogenetics 3q22.3
Domains SH2, SH3
Protein Families Druggable Genome
Protein Pathways Axon guidance, ErbB signaling pathway, Pathogenic Escherichia coli infection, T cell receptor signaling pathway
MW 42.9 kDa
Summary The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinases to downstream signal recipients such as RAS. Alternatively spliced transcript variants encoding different isoforms have been found. provided by RefSeq, Jun 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006153" in other vectors (7)
SKU Description Size Price
RC202869L1 Lenti ORF clone of Human NCK adaptor protein 1 (NCK1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC202869L2 Lenti ORF clone of Human NCK adaptor protein 1 (NCK1), transcript variant 1, mGFP tagged 10 ug
$757.00
RC202869L3 Lenti ORF clone of Human NCK adaptor protein 1 (NCK1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC202869L4 Lenti ORF clone of Human NCK adaptor protein 1 (NCK1), transcript variant 1, mGFP tagged 10 ug
$757.00
RG202869 NCK1 (tGFP-tagged) - Human NCK adaptor protein 1 (NCK1), transcript variant 1 10 ug
$489.00 $657.00
SC108190 NCK1 (untagged)-Human NCK adaptor protein 1 (NCK1), transcript variant 1 10 ug
$457.00
SC320755 NCK1 (untagged)-Human NCK adaptor protein 1 (NCK1), transcript variant 1 10 ug
$457.00

Plasmid Map for RC202869

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202869
Circular map for RC202869

file-alt Citations

SHIP interacts with adaptor protein Nck and restricts actin turnover in B cells
Pauls, Hou, Marshall
Biochem. Biophys. Res. Commun. (2020) 527 (1), 207-212 DOI: 10.1016/j.bbrc.2020.04.101
Cited by 3
AI Summary: In this study, the OriGene Nck-pCMV6-Entry plasmid was used for co-transfection experiments to investigate how overexpression of Nck influences SHIP-mediated regulation of actin dynamics in B cells.
Snippet: M. Jucker [13]) and, for FRAP experiments, 10 μg Actin-pTagRFP (Evrogen). Where Nck co-transfections were performed, Nck-pCMV6-Entry plasmid (Origene), which lacks a fluorescent tag, was used at 3x molar excess together with SHIP-pEGFP-C1
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products