OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFNGR1 (NM_000416) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202761
IFNGR1 (Myc-DDK-tagged)-Human interferon gamma receptor 1 (IFNGR1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA367686 IFNGR1 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "IFNGR1 or NM_000416"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IFNGR1
Synonyms CD119; IFNGR; IMD27A; IMD27B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202761 representing NM_000416
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTCCTCTTTCTCCTACCCCTTGTCATGCAGGGTGTGAGCAGGGCTGAGATGGGCACCGCGGATC
TGGGGCCGTCCTCAGTGCCTACACCAACTAATGTTACAATTGAATCCTATAACATGAACCCTATCGTATA
TTGGGAGTACCAGATCATGCCACAGGTCCCTGTTTTTACCGTAGAGGTAAAGAACTATGGTGTTAAGAAT
TCAGAATGGATTGATGCCTGCATCAATATTTCTCATCATTATTGTAATATTTCTGATCATGTTGGTGATC
CATCAAATTCTCTTTGGGTCAGAGTTAAAGCCAGGGTTGGACAAAAAGAATCTGCCTATGCAAAGTCAGA
AGAATTTGCTGTATGCCGAGATGGAAAAATTGGACCACCTAAACTGGATATCAGAAAGGAGGAGAAGCAA
ATCATGATTGACATATTTCACCCTTCAGTTTTTGTAAATGGAGACGAGCAGGAAGTCGATTATGATCCCG
AAACTACCTGTTACATTAGGGTGTACAATGTGTATGTGAGAATGAACGGAAGTGAGATCCAGTATAAAAT
ACTCACGCAGAAGGAAGATGATTGTGACGAGATTCAGTGCCAGTTAGCGATTCCAGTATCCTCACTGAAT
TCTCAGTACTGTGTTTCAGCAGAAGGAGTCTTACATGTGTGGGGTGTTACAACTGAAAAGTCAAAAGAAG
TTTGTATTACCATTTTCAATAGCAGTATAAAAGGTTCTCTTTGGATTCCAGTTGTTGCTGCTTTACTACT
CTTTCTAGTGCTTAGCCTGGTATTCATCTGTTTTTATATTAAGAAAATTAATCCATTGAAGGAAAAAAGC
ATAATATTACCCAAGTCCTTGATCTCTGTGGTAAGAAGTGCTACTTTAGAGACAAAACCTGAATCAAAAT
ATGTATCACTCATCACGTCATACCAGCCATTTTCCTTAGAAAAGGAGGTGGTCTGTGAAGAGCCGTTGTC
TCCAGCAACAGTTCCAGGCATGCATACCGAAGACAATCCAGGAAAAGTGGAACATACAGAAGAACTTTCT
AGTATAACAGAAGTGGTGACTACTGAAGAAAATATTCCTGACGTGGTCCCGGGCAGCCATCTGACTCCAA
TAGAGAGAGAGAGTTCTTCACCTTTAAGTAGTAACCAGTCTGAACCTGGCAGCATCGCTTTAAACTCGTA
TCACTCCAGAAATTGTTCTGAGAGTGATCACTCCAGAAATGGTTTTGATACTGATTCCAGCTGTCTGGAA
TCACATAGCTCCTTATCTGACTCAGAATTTCCCCCAAATAATAAAGGTGAAATAAAAACAGAAGGACAAG
AGCTCATAACCGTAATAAAAGCCCCCACCTCCTTTGGTTATGATAAACCACATGTGCTAGTGGATCTACT
TGTGGATGATAGCGGTAAAGAGTCCTTGATTGGTTATAGACCAACAGAAGATTCCAAAGAATTTTCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202761 representing NM_000416
Red=Cloning site Green=Tags(s)

MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKN
SEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQ
IMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLN
SQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGSLWIPVVAALLLFLVLSLVFICFYIKKINPLKEKS
IILPKSLISVVRSATLETKPESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELS
SITEVVTTEENIPDVVPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSCLE
SHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTEDSKEFS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_000416
ORF Size 1467 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000416.3
RefSeq Size 2059 bp
RefSeq ORF 1470 bp
Locus ID 3459
UniProt ID P15260
Cytogenetics 6q23.3
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity
MW 54.4 kDa
Summary This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_000416" in other vectors (7)
SKU Description Size Price
RC202761L1 Lenti ORF clone of Human interferon gamma receptor 1 (IFNGR1), Myc-DDK-tagged 10 ug
$757.00
RC202761L2 Lenti ORF clone of Human interferon gamma receptor 1 (IFNGR1), mGFP tagged 10 ug
$757.00
RC202761L3 Lenti ORF clone of Human interferon gamma receptor 1 (IFNGR1), Myc-DDK-tagged 10 ug
$757.00
RC202761L4 Lenti ORF clone of Human interferon gamma receptor 1 (IFNGR1), mGFP tagged 10 ug
$757.00
RG202761 IFNGR1 (tGFP-tagged) - Human interferon gamma receptor 1 (IFNGR1) 10 ug
$489.00 $657.00
SC119876 IFNGR1 (untagged)-Human interferon gamma receptor 1 (IFNGR1) 10 ug
$457.00
SC321055 IFNGR1 (untagged)-Human interferon gamma receptor 1 (IFNGR1) 10 ug
$457.00

Plasmid Map for RC202761

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202761
Circular map for RC202761

file-alt Citations

Casein kinase 1α mediates degradation of receptors for type I and type II interferons caused by hemagglutinin of influenza A virus
Xia, Wolf, Vijayan et al
J. Virol. (2018)
AI Summary: In this study, OriGene products contributed by providing the plasmid encoding FLAG and Myc-tagged human IFNGR1 for receptor expression experiments.
Snippet: SalI/KpnI-digested pCMV-Myc-N vector. Plasmid encoding FLAG and Myc tagged 165 human IFNGR1 was purchased form OriGene. For transient expression, HEK293 cells 166 Page 12. 12 OriGene;ON-TARGETplus Human IFNAR1 siRNA (J-020209-05) and ON
Targeted deep sequencing identifies rare loss-of-function variants in IFNGR1 for risk of atopic dermatitis complicated by eczema herpeticum
Gao, Bin, Rafaels et al
J. Allergy Clin. Immunol. (2015)
Cited by 47
AI Summary: OriGene’s pCMV6-entry IFNGR1 wild-type expression construct (RC202761) was used in this study to functionally investigate the impact of IFNGR1 loss-of-function variants identified in patients with atopic dermatitis complicated by eczema herpeticum.
Snippet: Functional testing of IFNGR1 loss-of-function variants. Site-directed mutagenesis. Mammalian expression construct of wild-type (WT) IFNGR1 (IFNGR1WT) in pCMV6-entry vector (RC202761) was purchased from Origene Technologies (Rockville, Md). ... Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products