OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IL18 (NM_001562) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202716
IL18 (Myc-DDK-tagged)-Human interleukin 18 (interferon-gamma-inducing factor) (IL18)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA324190 Anti-IL18 Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "IL18 or NM_001562"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IL18
Synonyms IGIF; IL-1g; IL-18; IL1F4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202716 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCTGAACCAGTAGAAGACAATTGCATCAACTTTGTGGCAATGAAATTTATTGACAATACGCTTT
ACTTTATAGCTGAAGATGATGAAAACCTGGAATCCGATTACTTTGGCAAGCTTGAATCTAAATTATCAGT
CATAAGAAATTTGAATGACCAAGTTCTCTTCATTGACCAAGGAAATCGGCCTCTATTTGAAGATATGACT
GATTCTGACTGTAGAGATAATGCACCCCGGACCATATTTATTATAAGTATGTATAAAGATAGCCAGCCTA
GAGGTATGGCTGTAACTATCTCTGTGAAGTGTGAGAAAATTTCAACTCTCTCCTGTGAGAACAAAATTAT
TTCCTTTAAGGAAATGAATCCTCCTGATAACATCAAGGATACAAAAAGTGACATCATATTCTTTCAGAGA
AGTGTCCCAGGACATGATAATAAGATGCAATTTGAATCTTCATCATACGAAGGATACTTTCTAGCTTGTG
AAAAAGAGAGAGACCTTTTTAAACTCATTTTGAAAAAAGAGGATGAATTGGGGGATAGATCTATAATGTT
CACTGTTCAAAACGAAGAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202716 protein sequence
Red=Cloning site Green=Tags(s)

MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMT
DSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQR
SVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001562
ORF Size 579 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001562.4
RefSeq Size 1163 bp
RefSeq ORF 582 bp
Locus ID 3606
UniProt ID Q14116
Cytogenetics 11q23.1
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway
MW 22.3 kDa
Summary The protein encoded by this gene is a proinflammatory cytokine of the IL-1 family that is constitutively found as a precursor within the cytoplasm of a variety of cells including macrophages and keratinocytes. The inactive IL-18 precursor is processed to its active form by caspase-1, and is capable of stimulating interferon gamma production, and of regulating both T helper (Th) 1 and Th2 responses. This cytokine has been implicated in the injury of different organs, and in potentially fatal conditions characterized by a cytokine storm. In humans, IL-18 gene is located on chromosome 11. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.provided by RefSeq, Aug 2020
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001562" in other vectors (6)
SKU Description Size Price
RC202716L1 Lenti ORF clone of Human interleukin 18 (interferon-gamma-inducing factor) (IL18), Myc-DDK-tagged 10 ug
$600.00
RC202716L2 Lenti ORF clone of Human interleukin 18 (interferon-gamma-inducing factor) (IL18), mGFP tagged 10 ug
$600.00
RC202716L3 Lenti ORF clone of Human interleukin 18 (interferon-gamma-inducing factor) (IL18), Myc-DDK-tagged 10 ug
$600.00
RC202716L4 Lenti ORF clone of Human interleukin 18 (interferon-gamma-inducing factor) (IL18), mGFP tagged 10 ug
$600.00
RG202716 IL18 (tGFP-tagged) - Human interleukin 18 (interferon-gamma-inducing factor) (IL18) 10 ug
$489.00 $500.00
SC315485 IL18 (untagged)-Human interleukin 18 (interferon-gamma-inducing factor) (IL18) 10 ug
$300.00

Plasmid Map for RC202716

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202716
Circular map for RC202716

file-alt Citations

Interleukin-23 engineering improves CAR T cell function in solid tumors
Ma, Shou, Smith et al
Nat. Biotechnol. (2020)
Cited by 253
AI Summary: OriGene cDNA clones for human IL12B (NM_002187.3), human IL18 (NM_001562.4), mouse Il12b (NM_001303244.1), mouse Il18 (NM_008360.2), and mouse Il15 (NM_008357.2) were used as PCR templates to generate constructs for engineering and testing cytokine-expressing CAR T cells in this study.
Snippet: (accession NM_002187.3), human IL18 (accession NM_001562.4), mouse Il12b (accession NM_001303244.1), mouse Il18 (accession NM_008360.2) and mouse Il15 (accession NM_008357.2) were amplified by PCR from cDNA clones purchased from Origene and cloned into the retroviral vector SFG. Human IL12B and IL18 were then subcloned into SFG vector containing an internal ribosomal entry site (IRES) and a truncated NGFR selectable marker (p40(i)NGFR;Supplementary Fig. 1a). …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products