OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RPRM (NM_019845) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202634
RPRM (Myc-DDK-tagged)-Human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RPRM or NM_019845"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RPRM
Synonyms REPRIMO
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202634 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCCGGCCCTAGGCAACCAGACGGACGTGGCGGGCCTGTTCCTGGCCAACAGCAGCGAGGCGCTGG
AGCGAGCCGTGCGCTGCTGCACCCAGGCGTCCGTGGTGACCGACGACGGCTTCGCGGAGGGAGGCCCGGA
CGAGCGTAGCCTGTACATAATGCGCGTGGTGCAGATCGCGGTCATGTGCGTGCTCTCACTCACCGTGGTC
TTCGGCATCTTCTTCCTCGGCTGCAATCTGCTCATCAAGTCCGAGGGCATGATCAACTTCCTCGTGAAGG
ACCGGAGGCCGTCTAAGGAGGTGGAGGCGGTGGTCGTGGGGCCCTAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202634 protein sequence
Red=Cloning site Green=Tags(s)

MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVV
FGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_019845
ORF Size 327 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019845.3
RefSeq Size 1496 bp
RefSeq ORF 330 bp
Locus ID 56475
UniProt ID Q9NS64
Cytogenetics 2q23.3
Protein Families Transmembrane
Protein Pathways p53 signaling pathway
MW 11.8 kDa
Summary May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_019845" in other vectors (6)
SKU Description Size Price
RC202634L1 Lenti ORF clone of Human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM), Myc-DDK-tagged 10 ug
$450.00
RC202634L2 Lenti ORF clone of Human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM), mGFP tagged 10 ug
$450.00
RC202634L3 Lenti ORF clone of Human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM), Myc-DDK-tagged 10 ug
$450.00
RC202634L4 Lenti ORF clone of Human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM), mGFP tagged 10 ug
$450.00
RG202634 RPRM (tGFP-tagged) - Human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM) 10 ug
$489.00
SC108659 RPRM (untagged)-Human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM) 10 ug
$150.00

Plasmid Map for RC202634

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202634
Circular map for RC202634

file-alt Citations

Loss of Expression of Reprimo, a p53-induced Cell Cycle Arrest Gene, Correlates with Invasive Stage of Tumor Progression and p73 Expression in Gastric Cancer
Saavedra, Valbuena, Olivares et al
PLoS ONE (2015) 10 (5), e0125834 DOI: 10.1371/journal.pone.0125834
Cited by 40
AI Summary: OriGene's pCMV6/RPRM expression plasmid and pCMV6 empty vector were used to transiently transfect AGS cells, enabling the validation of RPRM antibody by immunoblot and immunofluorescence and supporting functional assays in the study.
Snippet: Validation of RPRM antibody by Immunoblot and Immunofluorescence. 3x10 5 AGS cells were transiently transfected with pCMV6/RPRM or pCMV6 (Origene) empty vector, using Lipofectamine 2000 (Invitrogen), according to manufacturer's protocol. ... Cite SaveSaving
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products