OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TTF1 (NKX2-1) (NM_001079668) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC202477
NKX2 (Myc-DDK-tagged)-Human NK2 homeobox 1 (NKX2-1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
$289.00 $503.00
2 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA808440 NKX2-1 mouse monoclonal antibody, clone OTI10F8 (formerly 10F8) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TTF1 or NM_001079668"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TTF1
Synonyms BCH; BHC; NK-2; NKX2.1; NKX2A; NMTC1; T/EBP; TEBP; TITF1; TTF-1; TTF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202477 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGATGAGTCCAAAGCACACGACTCCGTTCTCAGTGTCTGACATCTTGAGTCCCCTGGAGGAAAGCT
ACAAGAAAGTGGGCATGGAGGGCGGCGGCCTCGGGGCTCCGCTGGCGGCGTACAGGCAGGGCCAGGCGGC
ACCGCCAACAGCGGCCATGCAGCAGCACGCCGTGGGGCACCACGGCGCCGTCACCGCCGCCTACCACATG
ACGGCGGCGGGGGTGCCCCAGCTCTCGCACTCCGCCGTGGGGGGCTACTGCAACGGCAACCTGGGCAACA
TGAGCGAGCTGCCGCCGTACCAGGACACCATGAGGAACAGCGCCTCTGGCCCCGGATGGTACGGCGCCAA
CCCAGACCCGCGCTTCCCCGCCATCTCCCGCTTCATGGGCCCGGCGAGCGGCATGAACATGAGCGGCATG
GGCGGCCTGGGCTCGCTGGGGGACGTGAGCAAGAACATGGCCCCGCTGCCAAGCGCGCCGCGCAGGAAGC
GCCGGGTGCTCTTCTCGCAGGCGCAGGTGTACGAGCTGGAGCGACGCTTCAAGCAACAGAAGTACCTGTC
GGCGCCGGAGCGCGAGCACCTGGCCAGCATGATCCACCTGACGCCCACGCAGGTCAAGATCTGGTTCCAG
AACCACCGCTACAAAATGAAGCGCCAGGCCAAGGACAAGGCGGCGCAGCAGCAACTGCAGCAGGACAGCG
GCGGCGGCGGGGGCGGCGGGGGCACCGGGTGCCCGCAGCAGCAACAGGCTCAGCAGCAGTCGCCGCGACG
CGTGGCGGTGCCGGTCCTGGTGAAAGACGGCAAACCGTGCCAGGCGGGTGCCCCCGCGCCGGGCGCCGCC
AGCCTACAAGGCCACGCGCAGCAGCAGGCGCAGCACCAGGCGCAGGCCGCGCAGGCGGCGGCAGCGGCCA
TCTCCGTGGGCAGCGGTGGCGCCGGCCTTGGCGCACACCCGGGCCACCAGCCAGGCAGCGCAGGCCAGTC
TCCGGACCTGGCGCACCACGCCGCCAGCCCCGCGGCGCTGCAGGGCCAGGTATCCAGCCTGTCCCACCTG
AACTCCTCGGGCTCGGACTACGGCACCATGTCCTGCTCCACCTTGCTATACGGTCGGACCTGG

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202477 protein sequence
Red=Cloning site Green=Tags(s)

MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHM
TAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGM
GGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQ
NHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAA
SLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHL
NSSGSDYGTMSCSTLLYGRTW

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_001079668
ORF Size 1203 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001079668.3
RefSeq Size 2197 bp
RefSeq ORF 1206 bp
Locus ID 7080
UniProt ID P43699
Cytogenetics 14q13.3
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
MW 41.7 kDa
Summary This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias 'TTF1' with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription. provided by RefSeq, Feb 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001079668" in other vectors (6)
SKU Description Size Price
RC202477L1 Lenti ORF clone of Human NK2 homeobox 1 (NKX2-1), transcript variant 1, Myc-DDK-tagged 10 ug
$803.00
RC202477L2 Lenti ORF clone of Human NK2 homeobox 1 (NKX2-1), transcript variant 1, mGFP tagged 10 ug
$803.00
RC202477L3 Lenti ORF clone of Human NK2 homeobox 1 (NKX2-1), transcript variant 1, Myc-DDK-tagged 10 ug
$803.00
RC202477L4 Lenti ORF clone of Human NK2 homeobox 1 (NKX2-1), transcript variant 1, mGFP tagged 10 ug
$803.00
RG202477 NKX2 (tGFP-tagged) - Human NK2 homeobox 1 (NKX2-1), transcript variant 1 10 ug
$489.00 $703.00
SC319511 NKX2 (untagged)-Human NK2 homeobox 1 (NKX2-1), transcript variant 1 10 ug
$457.00

Plasmid Map for RC202477

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202477
Circular map for RC202477

file-alt Citations

Homeobox Transcription Factor NKX2-1 Promotes Cyclin D1 Transcription in Lung Adenocarcinomas
Harada, Sakai, Ohhata et al
Mol. Cancer Res. (2017)
AI Summary: In this study, OriGene products—including the Myc-DDK-human NKX2-1 expression plasmid (Cat# RC202477) and qPCR primers for β-actin—were used to overexpress NKX2-1 and normalize transcript levels, respectively, enabling the authors to investigate how NKX2-1 regulates cyclin D1 transcription in lung adenocarcinoma cells.
Snippet: … The Myc-DDK-human NKX2-1 expression plasmid was purchased from Origene (MD #RC202477). …The Myc-DDK-human NKX2-1 expression plasmid was purchased from Origene (MD #RC202477). …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products