PEX11B (NM_003846) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC202018
PEX11B (Myc-DDK-tagged)-Human peroxisomal biogenesis factor 11 beta (PEX11B), transcript variant 1
$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PEX11B
Synonyms PEX11-BETA; PEX14B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202018 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGCCTGGGTCCGCTTCAGTGCTCAGAGCCAAGCCCGGGAGCGGCTGTGTAGGGCCGCCCAGTATG
CTTGCTCTCTTCTTGGCCATGCGCTGCAGAGGCATGGAGCCAGTCCTGAGTTACAGAAACAGATTCGACA
ACTGGAGAGCCACCTGAGCCTTGGAAGAAAGCTTCTACGCCTGGGTAACTCAGCAGATGCCCTTGAGTCA
GCCAAAAGAGCTGTTCACCTATCAGATGTTGTCCTGAGATTCTGCATCACTGTTAGTCACCTCAATCGAG
CCTTGTACTTCGTCTGTGACAATGTCCTGTGGGCTGGAAAGTCTGGACTGGCTCCCCGTGTGGATCAGGA
GAAGTGGGCCCAGCGTTCATTCAGGTACTATTTGTTTTCCCTCATCATGAATTTGAGCCGTGATGCTTAT
GAGATTCGCCTACTGATGGAGCAAGAGTCTTCTGCTTGTAGCCGGCGACTGAAAGGTTCTGGAGGAGGAG
TCCCAGGAGGAAGTGAAACTGGGGGACTTGGGGGACCAGGGACTCCAGGAGGAGGTCTGCCCCAACTGGC
TCTGAAACTTCGGCTGCAAGTCCTGCTCCTGGCTCGAGTCCTTAGAGGTCATCCCCCACTTCTGCTAGAC
GTGGTCAGAAATGCCTGTGATCTCTTCATTCCTCTGGACAAACTAGGCCTCTGGCGCTGTGGCCCTGGGA
TTGTGGGGCTTTGTGGCCTCGTGTCCTCCATCCTGTCTATTCTCACCCTAATCTATCCCTGGCTACGACT
CAAGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202018 protein sequence
Red=Cloning site Green=Tags(s)

MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLRLGNSADALES
AKRAVHLSDVVLRFCITVSHLNRALYFVCDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAY
EIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPGGGLPQLALKLRLQVLLLARVLRGHPPLLLD
VVRNACDLFIPLDKLGLWRCGPGIVGLCGLVSSILSILTLIYPWLRLKP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003846
ORF Size 777 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003846.3
RefSeq Size 1836 bp
RefSeq ORF 780 bp
Locus ID 8799
UniProt ID O96011
Cytogenetics 1q21.1
Protein Families Transmembrane
MW 28.5 kDa
Summary The protein encoded by this gene facilitates peroxisomal proliferation and interacts with PEX19. The encoded protein is found in the peroxisomal membrane. Several transcript variants, some protein-coding and some not protein-coding, have been found for this gene. [provided by RefSeq, Dec 2012]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
RC202018L1 Lenti ORF clone of Human peroxisomal biogenesis factor 11 beta (PEX11B), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202018L2 Lenti ORF clone of Human peroxisomal biogenesis factor 11 beta (PEX11B), transcript variant 1, mGFP tagged 10 ug
$600.00
RC202018L3 Lenti ORF clone of Human peroxisomal biogenesis factor 11 beta (PEX11B), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202018L4 Lenti ORF clone of Human peroxisomal biogenesis factor 11 beta (PEX11B), transcript variant 1, mGFP tagged 10 ug
$600.00
RG202018 PEX11B (tGFP-tagged) - Human peroxisomal biogenesis factor 11 beta (PEX11B), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC117711 PEX11B (untagged)-Human peroxisomal biogenesis factor 11 beta (PEX11B), transcript variant 1 10 ug
$300.00
SC322412 PEX11B (untagged)-Human peroxisomal biogenesis factor 11 beta (PEX11B), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.