OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ETS1 associated protein II (TDP2) (NM_016614) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202015
TDP2 (Myc-DDK-tagged)-Human tyrosyl-DNA phosphodiesterase 2 (TDP2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA811981 TDP2 mouse monoclonal antibody,clone OTI3G10 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "ETS1 associated protein II or NM_016614"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ETS1 associated protein II
Synonyms AD022; dJ30M3.3; EAP2; EAPII; hTDP2; TTRAP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202015 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTTGGGGAGTTGCCTGGAGGGCGGGAGGGAGGCGGCGGAGGAAGAGGGCGAGCCTGAGGTGAAAA
AGCGGCGACTTCTGTGTGTGGAGTTTGCCTCGGTCGCAAGCTGCGATGCCGCAGTGGCTCAGTGCTTCCT
GGCCGAGAACGACTGGGAGATGGAAAGGGCTCTGAACTCCTACTTCGAGCCTCCGGTGGAGGAGAGCGCC
TTGGAACGCCGACCTGAAACCATCTCTGAGCCCAAGACCTATGTTGACCTAACCAATGAAGAAACAACTG
ATTCCACCACTTCTAAAATCAGCCCATCTGAAGATACTCAGCAAGAAAATGGCAGCATGTTCTCTCTCAT
TACCTGGAATATTGATGGATTAGATCTAAACAATCTGTCAGAGAGGGCTCGAGGGGTGTGTTCCTACTTA
GCTTTGTACAGCCCAGATGTGATATTTCTACAGGAAGTTATTCCCCCATATTATAGCTACCTAAAGAAGA
GATCAAGTAATTATGAGATTATTACAGGTCATGAAGAAGGATATTTCACAGCTATAATGTTGAAGAAATC
AAGAGTGAAATTAAAAAGCCAAGAGATTATTCCTTTTCCAAGTACCAAAATGATGAGAAACCTTTTATGT
GTGCATGTGAATGTGTCAGGAAATGAGCTTTGCCTTATGACATCCCATTTGGAGAGCACCAGAGGGCATG
CTGCGGAACGAATGAATCAGTTAAAAATGGTTTTAAAGAAAATGCAAGAGGCTCCAGAGTCAGCTACAGT
TATATTTGCAGGAGATACAAATCTAAGGGATCGAGAGGTTACCAGATGTGGTGGTTTACCCAACAACATT
GTGGATGTCTGGGAGTTTTTGGGCAAACCTAAACATTGCCAGTATACATGGGATACACAAATGAACTCTA
ATCTTGGAATAACTGCTGCTTGTAAACTTCGTTTTGATCGAATATTTTTCAGAGCAGCAGCAGAAGAGGG
ACACATTATTCCCCGAAGTTTGGACCTTCTTGGATTAGAAAAACTGGACTGTGGTAGATTTCCTAGTGAT
CACTGGGGTCTTCTGTGCAACTTAGATATAATATTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202015 protein sequence
Red=Cloning site Green=Tags(s)

MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSYFEPPVEESA
LERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYL
ALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTKMMRNLLC
VHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNI
VDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSD
HWGLLCNLDIIL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_016614
ORF Size 1086 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016614.3
RefSeq Size 1940 bp
RefSeq ORF 1089 bp
Locus ID 51567
UniProt ID O95551
Cytogenetics 6p22.3
Domains Exo_endo_phos
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
MW 40.9 kDa
Summary This gene encodes a member of a superfamily of divalent cation-dependent phosphodiesterases. The encoded protein associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor associated factors (TRAFs), and inhibits nuclear factor-kappa-B activation. This protein has sequence and structural similarities with APE1 endonuclease, which is involved in both DNA repair and the activation of transcription factors. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_016614" in other vectors (6)
SKU Description Size Price
RC202015L1 Lenti ORF clone of Human tyrosyl-DNA phosphodiesterase 2 (TDP2), Myc-DDK-tagged 10 ug
$757.00
RC202015L2 Lenti ORF clone of Human tyrosyl-DNA phosphodiesterase 2 (TDP2), mGFP tagged 10 ug
$757.00
RC202015L3 Lenti ORF clone of Human tyrosyl-DNA phosphodiesterase 2 (TDP2), Myc-DDK-tagged 10 ug
$757.00
RC202015L4 Lenti ORF clone of Human tyrosyl-DNA phosphodiesterase 2 (TDP2), mGFP tagged 10 ug
$757.00
RG202015 TDP2 (tGFP-tagged) - Human tyrosyl-DNA phosphodiesterase 2 (TDP2) 10 ug
$657.00
SC324645 TDP2 (untagged)-Human tyrosyl-DNA phosphodiesterase 2 (TDP2) 10 ug
$457.00

Plasmid Map for RC202015

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202015
Circular map for RC202015

file-alt Citations

Mitochondrial tyrosyl-DNA phosphodiesterase 2 and its TDP2Sshort isoform
Huang, Dalla Rosa, Michaels et al
EMBO Rep. (2018)
AI Summary: OriGene’s human TDP2 cDNA ORF clone (RC202015) was used as the template for generating constructs to study the novel TDP2S isoform’s function and localization in this research.
Snippet: The first exon of cDNA for TDP2S was synthesized as a gblock (IDT) to swap out the first two exons of TDP2 in TDP2 human cDNA ORF clone (RC202015, OriGene, Rockville, MD)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products