OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NMU (NM_006681) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201939
NMU (Myc-DDK-tagged)-Human neuromedin U (NMU)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "NMU or NM_006681"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NMU
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201939 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCGAACAGAGAGCTGCCGCCCCAGGTCGCCCGCCGGACAGGTGGCCGCGGCGTCCCCGCTCCTGC
TGCTGCTGCTGCTGCTCGCCTGGTGCGCGGGCGCCTGCCGAGGTGCTCCAATATTACCTCAAGGATTACA
GCCTGAACAACAGCTACAGTTGTGGAATGAGATAGATGATACTTGTTCGTCTTTTCTGTCCATTGATTCT
CAGCCTCAGGCATCCAATGCACTGGAGGAGCTTTGCTTTATGATTATGGGAATGCTACCAAAGCCTCAGG
AACAAGATGAAAAAGATAATACTAAAAGGTTCTTATTTCATTATTCGAAGACACAGAAGTTGGGCAAGTC
AAATGTTGTGTCGTCAGTTGTGCATCCGTTGCTGCAGCTCGTTCCTCACCTGCATGAGAGAAGAATGAAG
AGATTCAGAGTGGACGAAGAATTCCAAAGTCCCTTTGCAAGTCAAAGTCGAGGATATTTTTTATTCAGGC
CACGGAATGGAAGAAGGTCAGCAGGGTTCATT

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201939 protein sequence
Red=Cloning site Green=Tags(s)

MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDS
QPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMK
RFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_006681
ORF Size 522 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006681.4
RefSeq Size 834 bp
RefSeq ORF 525 bp
Locus ID 10874
UniProt ID P48645, A0A250SH36
Cytogenetics 4q12
Protein Families Druggable Genome, Secreted Protein, Transmembrane
MW 19.7 kDa
Summary This gene encodes a member of the neuromedin family of neuropeptides. The encoded protein is a precursor that is proteolytically processed to generate a biologically active neuropeptide that plays a role in pain, stress, immune-mediated inflammatory diseases and feeding regulation. Increased expression of this gene was observed in renal, pancreatic and lung cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. Some of these isoforms may undergo similar processing to generate the mature peptide. provided by RefSeq, Jul 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006681" in other vectors (6)
SKU Description Size Price
RC201939L1 Lenti ORF clone of Human neuromedin U (NMU), Myc-DDK-tagged 10 ug
$600.00
RC201939L2 Lenti ORF clone of Human neuromedin U (NMU), mGFP tagged 10 ug
$600.00
RC201939L3 Lenti ORF clone of Human neuromedin U (NMU), Myc-DDK-tagged 10 ug
$600.00
RC201939L4 Lenti ORF clone of Human neuromedin U (NMU), mGFP tagged 10 ug
$600.00
RG201939 NMU (tGFP-tagged) - Human neuromedin U (NMU) 10 ug
$489.00 $500.00
SC128158 NMU (untagged)-Human neuromedin U (NMU) 10 ug
$300.00

Plasmid Map for RC201939

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201939
Circular map for RC201939

file-alt Citations

Neuromedin U promotes lung adenocarcinoma progression by enhancing nucleotide metabolism and potentiating fibrosis in the tumor microenvironment
Jiang, Li, Fan et al
Research Square (2025)
AI Summary: OriGene’s human NMU-tagged ORF clone (RC201939) was used to overexpress NMU in cells, enabling the authors to investigate NMU’s role in promoting lung adenocarcinoma progression and metabolic reprogramming.
Snippet: cell line LLC1 was maintained in DMEM medium (Gibco) supplemented with 10% 9 FBS. A human NMU-tagged ORF clone (RC201939) was purchased from OriGene 10 Technologies, Inc. For transfection, 2 µg of plasmid DNA was introduced into cells
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products