IFITM3 (NM_021034) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC201635
IFITM3 (Myc-DDK-tagged)-Human interferon induced transmembrane protein 3 (IFITM3)
$225.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IFITM3
Synonyms 1-8U; DSPA2b; IP15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201635 representing NM_021034
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCACACTGTCCAAACCTTCTTCTCTCCTGTCAACAGTGGCCAGCCCCCCAACTATGAGATGCTCA
AGGAGGAGCACGAGGTGGCTGTGCTGGGGGCGCCCCACAACCCTGCTCCCCCGACGTCCACCGTGATCCA
CATCCGCAGCGAGACCTCCGTGCCCGACCATGTCGTCTGGTCCCTGTTCAACACCCTCTTCATGAACCCC
TGCTGCCTGGGCTTCATAGCATTCGCCTACTCCGTGAAGTCTAGGGACAGGAAGATGGTTGGCGACGTGA
CCGGGGCCCAGGCCTATGCCTCCACCGCCAAGTGCCTGAACATCTGGGCCCTGATTCTGGGCATCCTCAT
GACCATTCTGCTCATCGTCATCCCAGTGCTGATCTTCCAGGCCTATGGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201635 representing NM_021034
Red=Cloning site Green=Tags(s)

MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNP
CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021034
ORF Size 399 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021034.3
RefSeq Size 808 bp
RefSeq ORF 402 bp
Locus ID 10410
UniProt ID Q01628
Cytogenetics 11p15.5
Domains CD225
Protein Families Transmembrane
MW 14.5 kDa
Summary The protein encoded by this gene is an interferon-induced membrane protein that helps confer immunity to influenza A H1N1 virus, West Nile virus, and dengue virus. Two transcript variants, only one of them protein-coding, have been found for this gene. Another variant encoding an N-terminally truncated isoform has been reported, but the full-length nature of this variant has not been determined. [provided by RefSeq, May 2012]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
RC201635L1 Lenti ORF clone of Human interferon induced transmembrane protein 3 (IFITM3), Myc-DDK-tagged 10 ug
$525.00
RC201635L2 Lenti ORF clone of Human interferon induced transmembrane protein 3 (IFITM3), mGFP tagged 10 ug
$525.00
RC201635L3 Lenti ORF clone of Human interferon induced transmembrane protein 3 (IFITM3), Myc-DDK-tagged 10 ug
$525.00
RC201635L4 Lenti ORF clone of Human interferon induced transmembrane protein 3 (IFITM3), mGFP tagged 10 ug
$525.00
RG201635 IFITM3 (tGFP-tagged) - Human interferon induced transmembrane protein 3 (IFITM3) 10 ug
$425.00
SC112616 IFITM3 (untagged)-Human interferon induced transmembrane protein 3 (IFITM3) 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.