OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Argininosuccinate Lyase (ASL) (NM_001024943) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201568
ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA804902 ASL mouse monoclonal antibody,clone OTI9G2 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Argininosuccinate Lyase or NM_001024943"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Argininosuccinate Lyase
Synonyms ASAL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201568 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCGGAGAGTGGGAAGCTTTGGGGTGGCCGGTTTGTGGGTGCAGTGGACCCCATCATGGAGAAGT
TCAACGCGTCCATTGCCTACGACCGGCACCTTTGGGAGGTGGATGTTCAAGGCAGCAAAGCCTACAGCAG
GGGCCTGGAGAAGGCAGGGCTCCTCACCAAGGCCGAGATGGACCAGATACTCCATGGCCTAGACAAGGTG
GCTGAGGAGTGGGCCCAGGGCACCTTCAAACTGAACTCCAATGATGAGGACATCCACACAGCCAATGAGC
GCCGCCTGAAGGAGCTCATTGGTGCAACGGCAGGGAAGCTGCACACGGGACGGAGCCGGAATGACCAGGT
GGTCACAGACCTCAGGCTGTGGATGCGGCAGACCTGCTCCACGCTCTCGGGCCTCCTCTGGGAGCTCATT
AGGACCATGGTGGATCGGGCAGAGGCGGAACGTGATGTTCTCTTCCCGGGGTACACCCATTTGCAGAGGG
CCCAGCCCATCCGCTGGAGCCACTGGATTCTGAGCCACGCCGTGGCACTGACCCGAGACTCTGAGCGGCT
GCTGGAGGTGCGGAAGCGGATCAATGTCCTGCCCCTGGGGAGTGGGGCCATTGCAGGCAATCCCCTGGGT
GTGGACCGAGAGCTGCTCCGAGCAGAACTCAACTTTGGGGCCATCACTCTCAACAGCATGGATGCCACTA
GTGAGCGGGACTTTGTGGCCGAGTTCCTGTTCTGGGCTTCGCTGTGCATGACCCATCTCAGCAGGATGGC
CGAGGACCTCATCCTCTACTGCACCAAGGAATTCAGCTTCGTGCAGCTCTCAGATGCCTACAGCACGGGA
AGCAGCCTGATGCCCCAGAAGAAAAACCCCGACAGTTTGGAGCTGATCCGGAGCAAGGCTGGGCGTGTGT
TTGGGCGGTGTGCCGGGCTCCTGATGACCCTCAAGGGACTTCCCAGCACCTACAACAAAGACTTACAGGA
GGACAAGGAAGCTGTGTTTGAAGTGTCAGACACTATGAGTGCCGTGCTCCAGGTGGCCACTGGCGTCATC
TCTACGCTGCAGATTCACCAAGAGAACATGGGACAGGCTCTCAGCCCCGACATGCTGGCCACTGACCTTG
CCTATTACCTGGTCCGCAAAGGGATGCCATTCCGCCAGGCCCACGAGGCCTCCGGGAAAGCTGTGTTCAT
GGCCGAGACCAAGGGGGTCGCCCTCAACCAGCTGTCACTGCAGGAGCTGCAGACCATCAGCCCCCTGTTC
TCGGGCGACGTGATCTGCGTGTGGGACTACGGGCACAGTGTGGAGCAGTATGGTGCCCTGGGCGGCACTG
CGCGCTCCAGCGTCGACTGGCAGATCCGCCAGGTGCGGGCGCTACTGCAGGCACAGCAGGCC

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201568 protein sequence
Red=Cloning site Green=Tags(s)

MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKV
AEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELI
RTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLG
VDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTG
SSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVI
STLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF
SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_001024943
ORF Size 1392 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001024943.2
RefSeq Size 2061 bp
RefSeq ORF 1395 bp
Locus ID 435
UniProt ID P04424, A0A024RDL8
Cytogenetics 7q11.21
Protein Pathways Alanine, Arginine and proline metabolism, aspartate and glutamate metabolism, Metabolic pathways
MW 51.7 kDa
Summary This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001024943" in other vectors (6)
SKU Description Size Price
RC201568L1 Lenti ORF clone of Human argininosuccinate lyase (ASL), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201568L2 Lenti ORF clone of Human argininosuccinate lyase (ASL), transcript variant 1, mGFP tagged 10 ug
$757.00
RC201568L3 Lenti ORF clone of Human argininosuccinate lyase (ASL), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201568L4 Lenti ORF clone of Human argininosuccinate lyase (ASL), transcript variant 1, mGFP tagged 10 ug
$757.00
RG201568 ASL (tGFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 1 10 ug
$489.00 $657.00
SC322186 ASL (untagged)-Human argininosuccinate lyase (ASL), transcript variant 1 10 ug
$457.00

Plasmid Map for RC201568

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201568
Circular map for RC201568

file-alt Citations

Silencing of argininosuccinate lyase inhibits colorectal cancer formation
Huang, Chen, Hsu et al
Oncol. Rep. (2016)
Cited by 32
AI Summary: OriGene contributed to this study by providing the ASL plasmid, which was used to investigate the role of argininosuccinate lyase in colorectal cancer cell growth and tumor formation.
Snippet: light chain 3 (LC3B) antibody (L7543) (Sigma-Aldrich, St. Louis, MO, uSA).The ASL plasmid was purchased from OriGene Technologies, Inc. (Rockville, MD, uSA).Cell culture. The human colon cancer cell lines HCT116 and ... Cite SaveSaving
Attenuation of argininosuccinate lyase inhibits cancer growth via cyclin A2 and nitric oxide
Huang, Hsu, Shieh et al
Mol. Cancer Ther. (2013)
AI Summary: OriGene’s Myc-tagged ASL (RC201568) expression plasmid was used in this study to investigate the role of argininosuccinate lyase in liver cancer cell growth and tumor progression.
Snippet: CA). Turbofect transfection reagent was from Fermentas (Glen Burnie, Maryland). Myc-tagged ASL (RC201568) was purchased from the OriGene Technologies, Inc. (Rockville, MD). The expression plasmid of cyclin A2 (NM_001237.3) was kindly obtained from Dr. Ih-Jen Su.
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products