OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRIP13 (NM_004237) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201285
TRIP13 (Myc-DDK-tagged)-Human thyroid hormone receptor interactor 13 (TRIP13), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA809737 TRIP13 mouse monoclonal antibody,clone OTI2F5 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TRIP13 or NM_004237"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TRIP13
Synonyms 16E1BP; MVA3; OOMD9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201285 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGAGGCCGTGGGCGACCTGAAGCAGGCGCTTCCCTGTGTGGCCGAGTCGCCAACGGTCCACGTGG
AGGTGCATCAGCGCGGCAGCAGCACTGCAAAGAAAGAAGACATAAACCTGAGTGTTAGAAAGCTACTCAA
CAGACATAATATTGTGTTTGGTGATTACACATGGACTGAGTTTGATGAACCTTTTTTGACCAGAAATGTG
CAGTCTGTGTCTATTATTGACACAGAATTAAAGGTTAAAGACTCACAGCCCATCGATTTGAGTGCATGCA
CTGTTGCACTTCACATTTTCCAGCTGAATGAAGATGGCCCCAGCAGTGAAAATCTGGAGGAAGAGACAGA
AAACATAATTGCAGCAAATCACTGGGTTCTACCTGCAGCTGAATTCCATGGGCTTTGGGACAGCTTGGTA
TACGATGTGGAAGTCAAATCCCATCTCCTCGATTATGTGATGACAACTTTACTGTTTTCAGACAAGAACG
TCAACAGCAACCTCATCACCTGGAACCGGGTGGTGCTGCTCCACGGTCCTCCTGGCACTGGAAAAACATC
CCTGTGTAAAGCGTTAGCCCAGAAATTGACAATTAGACTTTCAAGCAGGTACCGATATGGCCAATTAATT
GAAATAAACAGCCACAGCCTCTTTTCTAAGTGGTTTTCGGAAAGTGGCAAGCTGGTAACCAAGATGTTTC
AGAAGATTCAGGATTTGATTGATGATAAAGACGCCCTGGTGTTCGTGCTGATTGATGAGGTGGAGAGTCT
CACAGCCGCCCGAAATGCCTGCAGGGCGGGCACCGAGCCATCAGATGCCATCCGCGTGGTCAATGCTGTC
TTGACCCAAATTGATCAGATTAAAAGGCATTCCAATGTTGTGATTCTGACCACTTCTAACATCACCGAGA
AGATCGACGTGGCCTTCGTGGACAGGGCTGACATCAAGCAGTACATTGGGCCACCCTCTGCAGCAGCCAT
CTTCAAAATCTACCTCTCTTGTTTGGAAGAACTGATGAAGTGTCAGATCATATACCCTCGCCAGCAGCTG
CTGACCCTCCGAGAGCTAGAGATGATTGGCTTCATTGAAAACAACGTGTCAAAATTGAGCCTTCTTTTGA
ATGACATTTCAAGGAAGAGCGAGGGCCTCAGCGGCCGGGTCCTGAGAAAACTCCCCTTTCTGGCTCATGC
GCTGTATGTCCAGGCCCCCACCGTCACCATAGAGGGGTTCCTCCAGGCCCTGTCTCTGGCAGTGGACAAG
CAGTTTGAAGAGAGAAAGAAGCTTGCAGCTTACATC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201285 protein sequence
Red=Cloning site Green=Tags(s)

MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLTRNV
QSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEFHGLWDSLV
YDVEVKSHLLDYVMTTLLFSDKNVNSNLITWNRVVLLHGPPGTGKTSLCKALAQKLTIRLSSRYRYGQLI
EINSHSLFSKWFSESGKLVTKMFQKIQDLIDDKDALVFVLIDEVESLTAARNACRAGTEPSDAIRVVNAV
LTQIDQIKRHSNVVILTTSNITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQL
LTLRELEMIGFIENNVSKLSLLLNDISRKSEGLSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDK
QFEERKKLAAYI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004237
ORF Size 1296 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004237.4
RefSeq Size 2408 bp
RefSeq ORF 1299 bp
Locus ID 9319
UniProt ID Q15645
Cytogenetics 5p15.33
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
MW 48.6 kDa
Summary This gene encodes a protein that interacts with thyroid hormone receptors, also known as hormone-dependent transcription factors. The gene product interacts specifically with the ligand binding domain. This gene is one of several that may play a role in early-stage non-small cell lung cancer. provided by RefSeq, Oct 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004237" in other vectors (6)
SKU Description Size Price
RC201285L1 Lenti ORF clone of Human thyroid hormone receptor interactor 13 (TRIP13), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201285L2 Lenti ORF clone of Human thyroid hormone receptor interactor 13 (TRIP13), transcript variant 1, mGFP tagged 10 ug
$757.00
RC201285L3 Lenti ORF clone of Human thyroid hormone receptor interactor 13 (TRIP13), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201285L4 Lenti ORF clone of Human thyroid hormone receptor interactor 13 (TRIP13), transcript variant 1, mGFP tagged 10 ug
$757.00
RG201285 TRIP13 (tGFP-tagged) - Human thyroid hormone receptor interactor 13 (TRIP13), transcript variant 1 10 ug
$657.00
SC125723 TRIP13 (untagged)-Human thyroid hormone receptor interactor 13 (TRIP13), transcript variant 1 10 ug
$457.00

Plasmid Map for RC201285

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201285
Circular map for RC201285

file-alt Citations

CCAR2 functions downstream of the Shieldin complex to promote double-strand break end-joining
Iyer, Harada, Clairmont et al
Proc Natl Acad Sci U S A (2022) 119 (49), e2214935119 DOI: 10.1073/pnas.2214935119
Cited by 15
AI Summary: In this study, the OriGene product pCMV6-TRIP13-Myc-DDK (RC201285) was used to express TRIP13, enabling the authors to investigate its role alongside CCAR2 and the Shieldin complex in DNA double-strand break repair mechanisms.
Snippet: …The Save;Expression of SHLD1, SHLD2, and SHLD3 was induced by adding dox-ycycline—1 ug/ml. pCMV6-TRIP13-Myc-DDK was purchased from Origene (RC201285). …
TRIP13 promotes the proliferation and invasion of lung cancer cells via the Wnt signaling pathway and epithelial-mesenchymal transition
Li, Lei, Fei et al
J Mol Histol (2020)
Cited by 26
AI Summary: OriGene contributed to this study by providing the pCMV6-TRIP13 plasmid and the pCMV6 empty control vector, which were used to overexpress TRIP13 and serve as controls in lung cancer cell transfection experiments.
Snippet: … The pCMV6-TRIP13 plasmid and pCMV6, as empty control vector, were purchased from Origene (Rockville, MD, USA). … The pCMV6-TRIP13 plasmid and pCMV6, as empty control vector, were purchased from Origene (Rockville, MD, USA). …
TRIP13 and APC15 drive mitotic exit by turnover of interphase- and unattached kinetochore-produced MCC
Kim, Han, Ly et al
Nat Commun (2018) 9 (1), 4354 DOI: 10.1038/s41467-018-06774-1
AI Summary: OriGene's full-length TRIP13 ORF product was used to generate TRIP13 expression constructs, enabling the study of TRIP13's role in mitotic checkpoint regulation and mitotic exit in this research.
Snippet: several studies have highlighted that TRIP13 is overexpressed in many cancer types, and that high-level TRIP13 expression correlates with poor patient outcomes57,58. The contributions of TRIP13 to tumorigenesis and cancer progression remain largely mysterious. Here, we develop an inducible system to rapidly and completely deplete TRIP13 in cultured human cells by engineering auxin-inducible degro;Full-length ORFs of TRIP13 were obtained from OriGene technologies (Rockville, MD). cDNAs of TRIP13 were cloned into a pcDNA5/FRT/TO-based vector (Invitrogen) modified to contain an amino-terminus LAP tag. … TRIP13EQ variant (E253Q) was generated by QuickChangeII site-directed mutagenesis kit (Agilent)
FigureFigureFigure
TRIP13 promotes error-prone nonhomologous end joining and induces chemoresistance in head and neck cancer
Banerjee, Russo, Liu et al
Nat Commun (2014) 5, 4527 DOI: 10.1038/ncomms5527
Cited by 156
AI Summary: OriGene's pCMV6-Flag-TRIP13 and pCMV6-Flag control vector were used to overexpress TRIP13 in UM-SCC-1 cells, enabling the study of TRIP13's role in promoting error-prone DNA repair and chemoresistance in head and neck cancer.
Snippet: TRIP13 was downregulated with TRIP13 siRNA (Dharmacon, Lafayette, CO, USA;sequence of siRNA used is listed in Supplementary Fig. 1C). For overexpression of TRIP13, UM-SCC-1 cells were transfected with pCMV6-Flag-TRIP13 or pCMV6-Flag control vector (Origene, Rockville, MD, USA). For inducible TRIP13 downregulation, unique microRNA-30-based doxycycline-inducible Expression Arrest TRIPZ Lentiviral shRNAmir constructs were purchased from Thermo Scientific Open Biosystem
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products