OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRK fused gene (TFG) (NM_006070) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201093
TFG (Myc-DDK-tagged)-Human TRK-fused gene (TFG), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA503858 TFG (TRK fused gene) mouse monoclonal antibody, clone OTI2C3 (formerly 2C3) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TRK fused gene or NM_006070"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TRK fused gene
Synonyms HMSNP; SPG57; TF6; TRKT3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201093 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGGACAGTTGGATCTAAGTGGGAAGCTAATCATCAAAGCTCAACTTGGGGAGGATATTCGGCGAA
TTCCTATTCATAATGAAGATATTACTTATGATGAATTAGTGCTAATGATGCAACGAGTTTTCAGAGGAAA
ACTTCTGAGTAATGATGAAGTAACAATAAAGTATAAAGATGAAGATGGAGATCTTATAACAATTTTTGAT
AGTTCTGACCTTTCCTTTGCAATTCAGTGCAGTAGGATACTGAAACTGACATTATTTGTTAATGGCCAGC
CAAGACCCCTTGAATCAAGTCAGGTGAAATATCTCCGTCGAGAACTGATAGAACTTCGAAATAAAGTGAA
TCGTTTATTGGATAGCTTGGAACCACCTGGAGAACCAGGACCTTCCACCAATATTCCTGAAAATGATACT
GTGGATGGTAGGGAAGAAAAGTCTGCTTCTGATTCTTCTGGAAAACAGTCTACTCAGGTTATGGCAGCAA
GTATGTCTGCTTTTGATCCTTTAAAAAACCAAGATGAAATCAATAAAAATGTTATGTCAGCGTTTGGCTT
AACAGATGATCAGGTTTCAGGGCCACCCAGTGCTCCTGCAGAAGATCGTTCAGGAACACCCGACAGCATT
GCTTCCTCCTCCTCAGCAGCTCACCCACCAGGCGTTCAGCCACAGCAGCCACCATATACAGGAGCTCAGA
CTCAAGCAGGTCAGATTGAAGGTCAGATGTACCAACAGTACCAGCAACAGGCCGGCTATGGTGCACAGCA
GCCGCAGGCTCCACCTCAGCAGCCTCAACAGTATGGTATTCAGTATTCAGCAAGCTATAGTCAGCAGACT
GGACCTCAACAACCTCAGCAGTTCCAGGGATATGGCCAGCAACCAACTTCCCAGGCACCAGCTCCTGCCT
TTTCTGGTCAGCCTCAACAACTGCCTGCTCAGCCGCCACAGCAGTACCAGGCGAGCAATTATCCTGCACA
AACTTACACTGCCCAAACTTCTCAGCCTACTAATTATACTGTGGCTCCTGCCTCTCAACCTGGAATGGCT
CCAAGCCAACCTGGGGCCTATCAACCAAGACCAGGTTTTACTTCACTTCCTGGAAGTACCATGACCCCTC
CTCCAAGTGGGCCTAATCCTTATGCGCGTAACCGTCCTCCCTTTGGTCAGGGCTATACCCAACCTGGACC
TGGTTATCGA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201093 protein sequence
Red=Cloning site Green=Tags(s)

MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFD
SSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDT
VDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSI
ASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQT
GPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMA
PSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006070
ORF Size 1200 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006070.6
RefSeq Size 2090 bp
RefSeq ORF 1203 bp
Locus ID 10342
UniProt ID Q92734
Cytogenetics 3q12.2
Domains PB1
Protein Pathways Pathways in cancer, Thyroid cancer
MW 43.4 kDa
Summary There are several documented fusion oncoproteins encoded partially by this gene. This gene also participates in several oncogenic rearrangements resulting in anaplastic lymphoma and mixoid chondrosarcoma, and may play a role in the NF-kappaB pathway. Multiple transcript variants have been found for this gene. provided by RefSeq, Sep 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006070" in other vectors (7)
SKU Description Size Price
RC201093L1 Lenti ORF clone of Human TRK-fused gene (TFG), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201093L2 Lenti ORF clone of Human TRK-fused gene (TFG), transcript variant 1, mGFP tagged 10 ug
$757.00
RC201093L3 Lenti ORF clone of Human TRK-fused gene (TFG), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201093L4 Lenti ORF clone of Human TRK-fused gene (TFG), transcript variant 1, mGFP tagged 10 ug
$757.00
RG201093 TFG (tGFP-tagged) - Human TRK-fused gene (TFG), transcript variant 1 10 ug
$489.00 $657.00
SC127155 TFG (untagged)-Human TRK-fused gene (TFG), transcript variant 1 10 ug
$457.00
SC320314 TFG (untagged)-Human TRK-fused gene (TFG), transcript variant 1 10 ug
$457.00

Plasmid Map for RC201093

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201093
Circular map for RC201093

file-alt Citations

Characterization of Small-Molecule-Induced Changes in Parkinson's-Related Trafficking via the Nedd4 Ubiquitin Signaling Cascade
Hatstat, Ahrendt, Foster et al
Cell Chem Biol (2020) 28 (1), 14-25.e9 DOI: 10.1016/j.chembiol.2020.10.008
Cited by 23
AI Summary: OriGene contributed to this study by providing the pCMV-myc-DDK-TFG plasmid (Cat#RC200293), which was used to investigate the role of the trafficking scaffold protein TFG as a Nedd4 substrate in the context of Parkinson's-related trafficking defects.
Snippet: pCl-HA-Nedd4 Gao et al., 2009 Addgene#27002 pHM6-α-Synuclein-WT Furlong et al., 2000 Addgene#40824 pHM6-α-Synuclein-A53T Furlong et al., 2000 Addgene#40825 pCMV-myc-DDK-TFG OriGene Cat#RC200293
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products