Fibrillarin (FBL) (NM_001436) Human Tagged ORF Clone

SKU
RC200732
FBL (Myc-DDK-tagged)-Human fibrillarin (FBL)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Target Symbol Fibrillarin
Synonyms FIB; FLRN; Nop1; RNU3IP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200732 representing NM_001436
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCCAGGATTCAGTCCCCGTGGGGGTGGCTTTGGCGGCCGAGGGGGCTTTGGTGACCGTGGTGGTC
GTGGAGGCCGAGGGGGCTTTGGCGGGGGCCGAGGTCGAGGCGGAGGCTTTAGAGGTCGTGGACGAGGAGG
AGGTGGAGGCGGCGGCGGCGGTGGAGGAGGAGGAAGAGGTGGTGGAGGCTTCCATTCTGGTGGCAACCGG
GGTCGTGGTCGGGGAGGAAAAAGAGGAAACCAGTCGGGGAAGAATGTGATGGTGGAGCCGCATCGGCATG
AGGGTGTCTTCATTTGTCGAGGAAAGGAAGATGCACTGGTCACCAAGAACCTGGTCCCTGGGGAATCAGT
TTATGGAGAGAAGAGAGTCTCGATTTCGGAAGGAGATGACAAAATTGAGTACCGAGCCTGGAACCCCTTC
CGCTCCAAGCTAGCAGCAGCAATCCTGGGTGGTGTGGACCAGATCCACATCAAACCGGGGGCTAAGGTTC
TCTACCTCGGGGCTGCCTCGGGCACCACGGTCTCCCATGTCTCTGACATCGTTGGTCCGGATGGTCTAGT
CTATGCAGTCGAGTTCTCCCACCGCTCTGGCCGTGACCTCATTAACTTGGCCAAGAAGAGGACCAACATC
ATTCCTGTGATCGAGGATGCTCGACACCCACACAAATACCGCATGCTCATCGCAATGGTGGATGTGATCT
TTGCTGATGTGGCCCAGCCAGACCAGACCCGGATTGTGGCCCTGAATGCCCACACCTTCCTGCGTAATGG
AGGACACTTTGTGATTTCCATTAAGGCCAACTGCATTGACTCCACAGCCTCAGCCGAGGCCGTGTTTGCC
TCCGAAGTGAAAAAGATGCAACAGGAGAACATGAAGCCGCAGGAGCAGTTGACCCTTGAGCCATATGAAA
GAGACCATGCCGTGGTCGTGGGAGTGTACAGGCCACCCCCCAAGGTGAAGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200732 representing NM_001436
Red=Cloning site Green=Tags(s)

MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNR
GRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPF
RSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNI
IPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFA
SEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001436
ORF Size 963 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001436.4
RefSeq Size 1135 bp
RefSeq ORF 966 bp
Locus ID 2091
UniProt ID P22087
Cytogenetics 19q13.2
Domains Fibrillarin
Protein Families Stem cell - Pluripotency
MW 33.6 kDa
Summary This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Fibrillarin (FBL) (NM_001436) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200732L1 Lenti ORF clone of Human fibrillarin (FBL), Myc-DDK-tagged 10 ug
$750.00
RC200732L2 Lenti ORF clone of Human fibrillarin (FBL), mGFP tagged 10 ug
$750.00
RC200732L3 Lenti ORF clone of Human fibrillarin (FBL), Myc-DDK-tagged 10 ug
$750.00
RC200732L4 Lenti ORF clone of Human fibrillarin (FBL), mGFP tagged 10 ug
$750.00
RG200732 FBL (tGFP-tagged) - Human fibrillarin (FBL) 10 ug
$650.00
SC319339 FBL (untagged)-Human fibrillarin (FBL) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.