OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PAFAH2 (NM_000437) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200355
PAFAH2 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 2, 40kDa (PAFAH2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA366871 PAFAH2 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PAFAH2 or NM_000437"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PAFAH2
Synonyms HSD-PLA2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200355 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGTCAACCAGTCTGTGGGCTTTCCACCTGTCACAGGACCCCACCTCGTAGGCTGTGGGGATGTGA
TGGAGGGTCAGAATCTCCAGGGGAGCTTCTTTCGACTCTTCTACCCCTGCCAAAAGGCAGAGGAGACCAT
GGAGCAGCCCCTGTGGATTCCCCGCTATGAGTACTGCACTGGCCTGGCCGAGTACCTGCAGTTTAATAAG
CGCTGCGGGGGCTTGCTGTTCAACCTGGCGGTGGGATCTTGTCGCCTGCCTGTTAGCTGGAATGGCCCCT
TTAAGACAAAGGACTCTGGATACCCCTTGATCATCTTCTCCCATGGCCTAGGAGCCTTCAGGACTTTGTA
TTCAGCCTTCTGCATGGAGCTGGCCTCACGTGGCTTTGTGGTTGCTGTGCCAGAGCACAGGGACCGGTCA
GCGGCAACCACCTATTTCTGCAAGCAGGCCCCAGAAGAGAACCAGCCCACCAATGAATCGCTGCAGGAGG
AATGGATCCCTTTCCGTCGAGTTGAGGAAGGGGAGAAGGAATTTCATGTTCGGAATCCCCAGGTGCATCA
GCGGGTAAGCGAGTGTTTACGGGTGTTGAAGATCCTGCAAGAGGTCACTGCTGGGCAGACTGTCTTCAAC
ATCTTGCCTGGTGGCTTGGATCTGATGACTTTGAAGGGCAACATTGACATGAGCCGTGTGGCTGTGATGG
GACATTCATTTGGAGGGGCCACAGCTATTCTGGCTTTGGCCAAGGAGACCCAATTTCGGTGTGCGGTGGC
TCTGGATGCTTGGATGTTTCCTCTGGAACGTGACTTTTACCCCAAGGCCCGAGGACCTGTGTTCTTTATC
AATACTGAGAAATTCCAGACAATGGAGAGTGTCAATTTGATGAAGAAGATATGTGCCCAGCATGAACAGT
CTAGGATCATAACCGTTCTTGGTTCTGTTCATCGGAGTCAAACTGACTTTGCTTTTGTGACTGGCAACTT
GATTGGTAAATTCTTCTCCACTGAAACCCGTGGGAGCCTGGACCCCTATGAAGGGCAGGAGGTTATGGTA
CGGGCCATGTTGGCCTTCCTGCAGAAGCACCTCGACCTGAAAGAAGACTATAATCAATGGAACAACCTTA
TTGAAGGCATTGGACCGTCGCTCACCCCAGGGGCCCCCCACCATCTGTCCAGCCTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200355 protein sequence
Red=Cloning site Green=Tags(s)

MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNK
RCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRS
AATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFN
ILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFI
NTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMV
RAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_000437
ORF Size 1176 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000437.4
RefSeq Size 3581 bp
RefSeq ORF 1179 bp
Locus ID 5051
UniProt ID Q99487
Cytogenetics 1p36.11
Domains PAF-AH_p_II
Protein Families Druggable Genome
Protein Pathways Ether lipid metabolism, Metabolic pathways
MW 44 kDa
Summary This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_000437" in other vectors (4)
SKU Description Size Price
RC200355L3 Lenti ORF clone of Human platelet-activating factor acetylhydrolase 2, 40kDa (PAFAH2), Myc-DDK-tagged 10 ug
$757.00
RC200355L4 Lenti ORF clone of Human platelet-activating factor acetylhydrolase 2, 40kDa (PAFAH2), mGFP tagged 10 ug
$757.00
RG200355 PAFAH2 (tGFP-tagged) - Human platelet-activating factor acetylhydrolase 2, 40kDa (PAFAH2) 10 ug
$489.00 $657.00
SC319395 PAFAH2 (untagged)-Human platelet-activating factor acetylhydrolase 2, 40kDa (PAFAH2) 10 ug
$457.00

Plasmid Map for RC200355

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200355
Circular map for RC200355

file-alt Citations

Chemical probes for spatially resolved measurement of active enzymes in single cells
Li, Moellering
Methods Enzymol (2019) 628, 243-262 DOI: 10.1016/bs.mie.2019.06.017
Cited by 8
AI Summary: In this paper, OriGene products—specifically the anti-GAPDH antibody (OriGene, TA802519) and anti-ALDH1A1 antibody (OriGene, TA500053)—were used as key reagents to detect and quantify enzyme activity at the single-cell level using the activity-based proximity ligation (ADPL) platform.
FigureFigure
Chemical probes for spatially resolved measurement of active enzymes in single cells
Li, Moellering
Methods in Enzymology (2019)
AI Summary: OriGene’s PAFAH2-FLAG Plasmid (#RC200355) was used in this study to express tagged PAFAH2 enzyme, enabling the assessment of its activity and spatial localization with the ADPL platform.
Snippet: …Family-wide cathepsin cysteine protease-desthiobiotin probe (ActivX Biosciences, #AX13146) 4. … PAFAH2-FLAG Plasmid (Origene, #RC200355) 6. PAFAH2-FLAG-NLS Plasmid (nuclear location sequence-tagged;generated in-house by site-directed mutagenesis)
Elevated truncated oxidized phospholipids as a factor exacerbating ALI in the aging lungs
Ke, Karki, Kim et al
FASEB J. (2018)
AI Summary: OriGene contributed to this study by providing the DNA plasmid encoding Myc-FLAG-tagged PAFAH2, which was used to investigate the effects of PAFAH2 overexpression on endothelial cell dysfunction and lung injury in the context of aging and inflammation.
Snippet: Unless otherwise specified, all other biochemical re- agents were obtained from MilliporeSigma (Burlington, MA, USA). DNA plasmid encoding Myc-FLAG-tagged PAFAH2 was obtained from OriGene (Rockville, MD, USA). Transient
An activity-dependent proximity ligation platform for spatially resolved quantification of active enzymes in single cells
Li, Montgomery, Eckert et al
Nat Commun (2017) 8 (1), 1775 DOI: 10.1038/s41467-017-01854-0
Cited by 41
AI Summary: OriGene products, specifically the full-length human ESD (NM_001984) and PAFAH2 (NM_000437) in pCMV6 entry vectors with C-terminal Myc-DDK tag, were used to express target enzymes for validating the activity-dependent proximity ligation (ADPL) platform described in the study.
Snippet: Full-length, human ESD (NM_001984), and PAFAH2 (NM_000437) in pCMV6 entry vectors with C-terminal Myc-DDK tag were purchased from Origene
FigureFigureFigure
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products