OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

B4GALT7 (NM_007255) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200258
B4GALT7 (Myc-DDK-tagged)-Human xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 (galactosyltransferase I) (B4GALT7)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "B4GALT7 or NM_007255"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol B4GALT7
Synonyms EDSP1; EDSSLA; EDSSPD1; XGALT1; XGPT; XGPT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200258 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCCCTCGCGGAGGAAAGCGGCGCAGCTGCCCTGGGAGGACGGCAGGTCCGGGTTGCTCTCCGGCG
GCCTCCCTCGGAAGTGTTCCGTCTTCCACCTGTTCGTGGCCTGCCTCTCGCTGGGCTTCTTCTCCCTACT
CTGGCTGCAGCTCAGCTGCTCTGGGGACGTGGCCCGGGCAGTCAGGGGACAAGGGCAGGAGACCTCGGGC
CCTCCCCGCGCCTGCCCCCCAGAGCCGCCCCCTGAGCACTGGGAAGAAGACGCATCCTGGGGCCCCCACC
GCCTGGCAGTGCTGGTGCCCTTCCGCGAACGCTTCGAGGAGCTCCTGGTCTTCGTGCCCCACATGCGCCG
CTTCCTGAGCAGGAAGAAGATCCGGCACCACATCTACGTGCTCAACCAGGTGGACCACTTCAGGTTCAAC
CGGGCAGCGCTCATCAACGTGGGCTTCCTGGAGAGCAGCAACAGCACGGACTACATTGCCATGCACGACG
TTGACCTGCTCCCTCTCAACGAGGAGCTGGACTATGGCTTTCCTGAGGCTGGGCCCTTCCACGTGGCCTC
CCCGGAGCTCCACCCTCTCTACCACTACAAGACCTATGTCGGCGGCATCCTGCTGCTCTCCAAGCAGCAC
TACCGGCTGTGCAATGGGATGTCCAACCGCTTCTGGGGCTGGGGCCGCGAGGACGACGAGTTCTACCGGC
GCATTAAGGGAGCTGGGCTCCAGCTTTTCCGCCCCTCGGGAATCACAACTGGGTACAAGACATTTCGCCA
CCTGCATGACCCAGCCTGGCGGAAGAGGGACCAGAAGCGCATCGCAGCTCAAAAACAGGAGCAGTTCAAG
GTGGACAGGGAGGGAGGCCTGAACACTGTGAAGTACCATGTGGCTTCCCGCACTGCCCTGTCTGTGGGCG
GGGCCCCCTGCACTGTCCTCAACATCATGTTGGACTGTGACAAGACCGCCACACCCTGGTGCACATTCAG
C

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200258 protein sequence
Red=Cloning site Green=Tags(s)

MFPSRRKAAQLPWEDGRSGLLSGGLPRKCSVFHLFVACLSLGFFSLLWLQLSCSGDVARAVRGQGQETSG
PPRACPPEPPPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFN
RAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVGGILLLSKQH
YRLCNGMSNRFWGWGREDDEFYRRIKGAGLQLFRPSGITTGYKTFRHLHDPAWRKRDQKRIAAQKQEQFK
VDREGGLNTVKYHVASRTALSVGGAPCTVLNIMLDCDKTATPWCTFS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007255
ORF Size 981 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007255.3
RefSeq Size 1747 bp
RefSeq ORF 984 bp
Locus ID 11285
UniProt ID Q9UBV7
Cytogenetics 5q35.3
Domains Galactosyl_T_2
Protein Families Transmembrane
Protein Pathways Chondroitin sulfate biosynthesis, Heparan sulfate biosynthesis, Metabolic pathways
MW 37.4 kDa
Summary This gene is a member of the beta-1,4-galactosyltransferase (beta4GalT) family. Family members encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose. Each beta4GalT member has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus which then remains uncleaved to function as a transmembrane anchor. The enzyme encoded by this gene attaches the first galactose in the common carbohydrate-protein linkage (GlcA-beta1,3-Gal-beta1,3-Gal-beta1,4-Xyl-beta1-O-Ser) found in proteoglycans. This enzyme differs from other beta4GalTs because it lacks the conserved Cys residues found in beta4GalT1-beta4GalT6 and it is located in cis-Golgi instead of trans-Golgi. Mutations in this gene have been associated with the progeroid form of Ehlers-Danlos syndrome. provided by RefSeq, Oct 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_007255" in other vectors (4)
SKU Description Size Price
RC200258L3 Lenti ORF clone of Human xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 (galactosyltransferase I) (B4GALT7), Myc-DDK-tagged 10 ug
$600.00
RC200258L4 Lenti ORF clone of Human xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 (galactosyltransferase I) (B4GALT7), mGFP tagged 10 ug
$600.00
RG200258 B4GALT7 (tGFP-tagged) - Human xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 (galactosyltransferase I) (B4GALT7) 10 ug
$489.00 $500.00
SC319505 B4GALT7 (untagged)-Human xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 (galactosyltransferase I) (B4GALT7) 10 ug
$300.00

Plasmid Map for RC200258

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200258
Circular map for RC200258

file-alt Citations

Visualizing intra-Golgi localization and transport by side-averaging Golgi ministacks
Tie, Mahajan, Lu
J Cell Biol (2022) 221 (6) DOI: 10.1083/jcb.202109114
Cited by 43
AI Summary: OriGene products B4GALT7-Myc (#RC200258), B3GALT6-Myc (#MR204731), POMGNT1-Myc (#RC200176), SLC35C1-Myc (#RC200101), and SMS1-Myc (#MR206639) were used as tagged Golgi protein constructs to visualize and analyze the cisternal organization and intra-Golgi transport in this study.
Snippet: … B4GALT7-Myc (#RC200258), B3GALT6-Myc (#MR204731), POMGNT1-Myc (#RC200176), SLC35C1-Myc (#RC200101), and SMS1-Myc (#MR206639) were purchased from Origene. …B4GALT7-Myc (#RC200258), B3GALT6-Myc (#MR204731), POMGNT1-Myc (#RC200176), SLC35C1-Myc (#RC200101), and SMS1-Myc (#MR206639) were purchased from Origene. …
Expansion of B4GALT7 linkeropathy phenotype to include perinatal lethal skeletal dysplasia
Mihalic Mosher, Zygmunt, Koboldt et al
Eur. J. Hum. Genet. (2019)
AI Summary: OriGene’s human B4GALT7 gene plasmid (NM_007255) was used as the template for site-directed mutagenesis to generate and study patient-specific B4GALT7 variants in this research.
Snippet: Site-directed mutagenesis. A plasmid containing the open reading frame of the human B4GALT7 gene was purchased from Origene (NM_007255, Rockville, MD). Primers were designed to create the patient B4GALT7 variants
The spatial separation of processing and transport functions to the interior and periphery of the Golgi stack
Tie, Ludwig, Sandin et al
Elife (2018) 7 DOI: 10.7554/eLife.41301
AI Summary: In this study, OriGene products SLC35C1-Myc (Cat. No.: RC200101), β3GalT6-Myc (Cat. No.: MR204731), and β4GalT7-Myc (Cat. No.: RC200258) were used as recombinant DNA reagents to label and study specific Golgi components, enabling the authors to investigate the spatial organization of processing and transport functions within the Golgi complex.
Snippet: le 3 Recombinant DNA reagent β4GalT3-Myc this paper See Supplementary file 3 Recombinant DNA reagent GalT-mCherry PMID: 26764092 Recombinant DNA reagent SLC35C1-Myc OriGene Technologies Inc. … No.: RC200101 Recombinant DNA reagent β3GalT6-Myc OriGene Technologies Inc. … No.: MR204731 Recombinant DNA reagent β4GalT7-Myc OriGene Te;Recombinant DNA reagent SLC35C1-Myc OriGene Technologies Inc. … No.: RC200101 Recombinant DNA reagent β3GalT6-Myc OriGene Technologies Inc. … No.: MR204731 Recombinant DNA reagent β4GalT7-Myc OriGene Technologies Inc. … No.: RC200258
FigureFigureFigure
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products