OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KCTD5 (NM_018992) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200180
KCTD5 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 5 (KCTD5)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA501035 Anti-KCTD5 mouse monoclonal antibody, clone OTI3C8 (formerly 3C8) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "KCTD5 or NM_018992"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KCTD5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200180 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGAATCACTGCGAGCTCCTGTCGCCGGCCCGGGGCGGCATCGGGGCGGGGCTGGGGGGCGGCC
TGTGCCGCCGCTGCAGCGCTGGGCTCGGCGCCCTGGCCCAGCGCCCTGGCAGCGTGTCCAAGTGGGTCCG
ACTCAACGTCGGCGGCACCTACTTCCTCACCACTCGGCAGACCCTGTGCCGGGACCCGAAATCCTTCCTG
TACCGCTTATGCCAGGCCGATCCCGACCTGGACTCAGACAAGGATGAAACAGGCGCCTATTTAATCGACA
GAGACCCCACCTACTTTGGGCCTGTGCTGAACTACCTGAGACACGGCAAGCTGGTGATTAACAAAGACCT
CGCGGAGGAAGGAGTGTTGGAGGAAGCAGAATTTTACAATATCACCTCATTAATAAAACTTGTAAAGGAC
AAAATTAGAGAACGAGACAGCAAAACATCGCAGGTGCCTGTGAAGCATGTGTACCGTGTGCTGCAGTGCC
AGGAGGAGGAGCTCACGCAGATGGTGTCCACCATGTCCGACGGCTGGAAGTTCGAGCAGTTGGTCAGCAT
CGGCTCCTCTTACAACTATGGGAACGAAGACCAAGCCGAGTTCCTCTGTGTGGTGTCCAAGGAGCTGCAC
AACACCCCGTACGGTACGGCCAGCGAGCCCAGCGAGAAGGCCAAGATTTTGCAAGAACGAGGCTCAAGGA
TG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200180 protein sequence
Red=Cloning site Green=Tags(s)

MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFL
YRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKD
KIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELH
NTPYGTASEPSEKAKILQERGSRM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_018992
ORF Size 702 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018992.4
RefSeq Size 2479 bp
RefSeq ORF 705 bp
Locus ID 54442
UniProt ID Q9NXV2
Cytogenetics 16p13.3
Domains BTB, K_tetra
Protein Families Ion Channels: Other
MW 26.1 kDa
Summary Its interaction with CUL3 suggests that it may act as a substrate adapter in some E3 ligase complex (PubMed:18573101). Does not affect the function of Kv channel Kv2.1/KCNB1, Kv1.2/KCNA2, Kv4.2/KCND2 and Kv3.4/KCNC4 (PubMed:19361449).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_018992" in other vectors (7)
SKU Description Size Price
RC200180L1 Lenti ORF clone of Human potassium channel tetramerisation domain containing 5 (KCTD5), Myc-DDK-tagged 10 ug
$600.00
RC200180L2 Lenti ORF clone of Human potassium channel tetramerisation domain containing 5 (KCTD5), mGFP tagged 10 ug
$600.00
RC200180L3 Lenti ORF clone of Human potassium channel tetramerisation domain containing 5 (KCTD5), Myc-DDK-tagged 10 ug
$600.00
RC200180L4 Lenti ORF clone of Human potassium channel tetramerisation domain containing 5 (KCTD5), mGFP tagged 10 ug
$600.00
RG200180 KCTD5 (tGFP-tagged) - Human potassium channel tetramerisation domain containing 5 (KCTD5) 10 ug
$489.00 $500.00
SC310612 KCTD5 (untagged)-Human potassium channel tetramerisation domain containing 5 (KCTD5) 10 ug
$330.00
SC320723 KCTD5 (untagged)-Human potassium channel tetramerisation domain containing 5 (KCTD5) 10 ug
$300.00

Plasmid Map for RC200180

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200180
Circular map for RC200180

file-alt Citations

Multiple potassium channel tetramerization domain (KCTD) family members interact with Gβγ, with effects on cAMP signaling
Sloan, Cryan, Muntean
J Biol Chem (2023) 299 (3), 102924 DOI: 10.1016/j.jbc.2023.102924
Cited by 25
AI Summary: In this study, OriGene products—including Myc-DDK-tagged human KCTD2, KCTD5, and KCTD17 expression plasmids—were used to investigate the interactions between KCTD family proteins and Gβγ subunits, enabling the authors to characterize how these proteins modulate cAMP signaling pathways.
FigureFigureFigure
Multiple Potassium Channel Tetramerization Domain (KCTD) family members interact with Gβγ, with effects on cAMP signaling
Sloan, Cryan, Muntean
Journal of Biological Chemistry (2023) 299 (3), 102924 DOI: 10.1016/j.jbc.2023.102924
Cited by 25
AI Summary: OriGene products KCTD2-myc (RC218957), KCTD5-myc (RC200180), KCTD8-myc (RC223904), and KCTD12-myc (RC204577) were used as expression constructs to study the interactions between KCTD family proteins and Gβγ, helping to elucidate their role in modulating cAMP signaling.
Snippet: ), Venus 156-239-Gβ1 (27), Venus 1-155-Gγ2 (27), pmCherry-N1 (Takara Bio;catalog no.: 632523), pmVenus-N1 (68), masGRK3ct (69), masGRK3ct-Nluc (29), PTX-S1 (70), TEpacVV (31), AC5 (37), KCTD2-myc (Origene;catalog no.: RC218957), KCTD5-myc (Origene;catalog no.: RC200180), KCTD8-myc (Origene;catalog no.: RC223904), KCTD12-myc (Origene;catalog no.: RC204577), KCTD16-myc (Origene;catalog no.:
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products