Ccr6 (NM_001190334) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MR227486
Ccr6 (Myc-DDK-tagged) - Mouse chemokine (C-C motif) receptor 6 (Ccr6), transcript variant 3
$289.00 $457.00
In Stock*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ccr6
Synonyms CC-CKR-6; CCR-6; Cmkbr6; KY411
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR227486 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATTCCACAGAGTCCTACTTTGGAACGGATGATTATGACAACACAGAGTATTATTCTATTCCTCCAG
ACCATGGGCCATGCTCCCTAGAAGAGGTCAGAAACTTCACCAAGGTATTTGTGCCAATTGCCTACTCCTT
AATATGTGTCTTTGGCCTCCTGGGCAACATTATGGTGGTGATGACCTTTGCCTTCTACAAGAAAGCCAGA
TCCATGACTGACGTCTACCTGTTGAACATGGCCATCACAGACATACTCTTTGTCCTCACCCTACCGTTCT
GGGCAGTTACTCATGCCACCAACACTTGGGTTTTCAGCGATGCACTGTGTAAACTGATGAAAGGCACATA
TGCGGTCAACTTTAACTGTGGGATGCTGCTCCTGGCCTGTATCAGCATGGACCGGTACATTGCCATCGTC
CAGGCAACCAAATCTTTCCGGGTACGCTCCAGAACACTGACGCACAGTAAGGTCATCTGTGTGGCAGTGT
GGTTCATCTCCATCATCATCTCAAGCCCTACATTTATCTTCAACAAGAAATACGAGCTGCAGGATCGTGA
TGTCTGTGAGCCACGGTACAGGTCTGTCTCAGAGCCCATCACGTGGAAGCTGCTGGGTATGGGACTGGAG
CTGTTCTTTGGGTTCTTCACCCCTTTGCTGTTTATGGTGTTCTGCTATCTGTTCATTATCAAGACCTTGG
TGCAGGCCCAGAACTCCAAGAGGCACAGAGCAATCCGAGTCGTGATCGCTGTGGTTCTCGTGTTCCTGGC
TTGTCAGATCCCTCACAACATGGTCCTCCTCGTGACTGCGGTCAACACGGGCAAAGTGGGCCGGAGCTGC
AGCACCGAGAAAGTCCTCGCCTACACCAGGAACGTGGCCGAGGTCCTGGCTTTCCTGCATTGCTGCCTCA
ACCCCGTGTTGTATGCGTTTATTGGACAGAAATTCAGAAACTACTTCATGAAGATCATGAAGGATGTGTG
GTGTATGAGAAGGAAGAATAAGATGCCTGGCTTCCTCTGTGCCCGGGTTTACTCGGAAAGCTACATCTCC
AGGCAGACCAGTGAGACCGTCGAAAATGATAATGCATCGTCCTTTACCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR227486 protein sequence
Red=Cloning site Green=Tags(s)

MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAYSLICVFGLLGNIMVVMTFAFYKKAR
SMTDVYLLNMAITDILFVLTLPFWAVTHATNTWVFSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIV
QATKSFRVRSRTLTHSKVICVAVWFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLE
LFFGFFTPLLFMVFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSC
STEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLCARVYSESYIS
RQTSETVENDNASSFTM

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001190334
ORF Size 1101 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001190334.1, NP_001177263.1
RefSeq Size 1439 bp
RefSeq ORF 1104 bp
Locus ID 12458
UniProt ID O54689
Cytogenetics 17 A1
MW 42.1 kDa
Summary Receptor for the C-C type chemokine CCL20. Binds to CCL20 and subsequently transduces a signal by increasing the intracellular calcium ion levels (PubMed:20068036). Although CCL20 is its major ligand it can also act as a receptor for non-chemokine ligands such as beta-defensins (PubMed:25122636). Binds to defensin DEFB1 leading to increase in intracellular calcium ions and cAMP levels. Its binding to DEFB1 is essential for the function of DEFB1 in regulating sperm motility and bactericidal activity (By similarity). Binds to defensins DEFB4 and DEFB4A/B and mediates their chemotactic effects (PubMed:20068036). The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases. CCR6-mediated signals are essential for immune responses to microbes in the intestinal mucosa and in the modulation of inflammatory responses initiated by tissue insult and trauma (PubMed:21376174). CCR6 is essential for the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation (PubMed:19050256). Required for the normal migration of Th17 cells in Peyers patches and other related tissue sites of the intestine and plays a role in regulating effector T-cell balance and distribution in inflamed intestine (PubMed:19129757). Plays an important role in the coordination of early thymocyte precursor migration events important for normal subsequent thymocyte precursor development, but is not required for the formation of normal thymic natural regulatory T-cells (nTregs). Required for optimal differentiation of DN2 and DN3 thymocyte precursors (PubMed:24638065). Essential for B-cell localization in the subepithelial dome of Peyers-patches and for efficient B-cell isotype switching to IgA in the Peyers-patches (PubMed:27174992). Essential for appropriate anatomical distribution of memory B-cells in the spleen and for the secondary recall response of memory B-cells (PubMed:25505290). Positively regulates sperm motility and chemotaxis via its binding to CCL20 (PubMed:23765988).UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001190334" in other vectors (4)
SKU Description Size Price
MC208234 Ccr6 (untagged) - Mouse chemokine (C-C motif) receptor 6 (Ccr6), transcript variant 3, (10ug) 10 ug
$503.00
MG227486 Ccr6 (tGFP-tagged) - Mouse chemokine (C-C motif) receptor 6 (Ccr6) transcript variant 3, (10ug) 10 ug
$657.00
MR227486L3 Lenti ORF clone of Ccr6 (Myc-DDK-tagged) - Mouse chemokine (C-C motif) receptor 6 (Ccr6), transcript variant 3 10 ug
$757.00
MR227486L4 Lenti ORF clone of Ccr6 (mGFP-tagged) - Mouse chemokine (C-C motif) receptor 6 (Ccr6), transcript variant 3 10 ug
$757.00

Plasmid Map for MR227486

Download sequence for

Cloning scheme for MR227486

Circular map for MR227486

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products