OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Socs1 (NM_009896) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR226604
Socs1 (Myc-DDK-tagged) - Mouse suppressor of cytokine signaling 1 (Socs1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Socs1 or NM_009896"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Socs1
Synonyms Cish1; Cish7; JAB; SOCS-1; SSI-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226604 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTAGCACGCAACCAGGTGGCAGCCGACAATGCGATCTCCCCGGCAGCAGAGCCCCGACGGCGGTCAG
AGCCCTCCTCGTCCTCGTCTTCGTCCTCGCCAGCGGCCCCCGTGCGTCCCCGGCCCTGCCCGGCGGTCCC
AGCCCCAGCCCCTGGCGACACTCACTTCCGCACCTTCCGCTCCCACTCCGATTACCGGCGCATCACGCGG
ACCAGCGCGCTCCTGGACGCCTGCGGCTTCTATTGGGGACCCCTGAGCGTGCACGGGGCGCACGAGCGGC
TGCGTGCCGAGCCCGTGGGCACCTTCTTGGTGCGCGACAGTCGCCAACGGAACTGCTTCTTCGCGCTCAG
CGTGAAGATGGCTTCGGGCCCCACGAGCATCCGCGTGCACTTCCAGGCCGGCCGCTTCCACTTGGACGGC
AGCCGCGAGACCTTCGACTGCCTTTTCGAGCTGCTGGAGCACTACGTGGCGGCGCCGCGCCGCATGTTGG
GGGCCCCGCTGCGCCAGCGCCGCGTGCGGCCGCTGCAGGAGCTGTGTCGCCAGCGCATCGTGGCCGCCGT
GGGTCGCGAGAACCTGGCGCGCATCCCTCTTAACCCGGTACTCCGTGACTACCTGAGTTCCTTCCCCTTC
CAGATC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR226604 protein sequence
Red=Cloning site Green=Tags(s)

MVARNQVAADNAISPAAEPRRRSEPSSSSSSSSPAAPVRPRPCPAVPAPAPGDTHFRTFRSHSDYRRITR
TSALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDG
SRETFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVAAVGRENLARIPLNPVLRDYLSSFPF
QI

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_009896
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009896.2, NP_034026.1
RefSeq Size 1220 bp
RefSeq ORF 639 bp
Locus ID 12703
UniProt ID O35716
Cytogenetics 16 5.81 cM
MW 23.7 kDa
Summary SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS1 is involved in negative regulation of cytokines that signal through the JAK/STAT3 pathway. Through binding to JAKs, inhibits their kinase activity. In vitro, also suppresses Tec protein-tyrosine activity (By similarity). Appears to be a major regulator of signaling by interleukin 6 (IL6) and leukemia inhibitory factor (LIF). Regulates interferon-gamma mediated sensory neuron survival. Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize JAK2 (By similarity). SOCS1 appears to be a negative regulator in IGF1R signaling pathway (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_009896" in other vectors (4)
SKU Description Size Price
MC208285 Socs1 (untagged) - Mouse suppressor of cytokine signaling 1 (Socs1), (10ug) 10 ug
$300.00
MG226604 Socs1 (tGFP-tagged) - Mouse suppressor of cytokine signaling 1 (Socs1), (10ug) 10 ug
$489.00 $500.00
MR226604L3 Lenti ORF clone of Socs1 (Myc-DDK-tagged) - Mouse suppressor of cytokine signaling 1 (Socs1) 10 ug
$600.00
MR226604L4 Lenti ORF clone of Socs1 (mGFP-tagged) - Mouse suppressor of cytokine signaling 1 (Socs1) 10 ug
$600.00

Plasmid Map for MR226604

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR226604
Circular map for MR226604

file-alt Citations

OTUB1 inhibits CNS autoimmunity by preventing IFN-γ-induced hyperactivation of astrocytes
Wang, Mulas, Yi et al
EMBO J (2019) 38 (10) DOI: 10.15252/embj.2018100947
Cited by 63
AI Summary: In this study, OriGene products—specifically the OTUB1 shRNA (TL515935) and mouse OTUB1 cDNA (MR207703)—were used to manipulate OTUB1 expression in astrocytes, enabling the authors to investigate OTUB1's role in regulating neuroinflammation during CNS autoimmunity.
NOS1-derived nitric oxide promotes NF-κB transcriptional activity through inhibition of suppressor of cytokine signaling-1
Baig, Zaichick, Mao et al
J. Exp. Med. (2015) 212 (10), 1725-1738 DOI: 10.1084/jem.20140654
Cited by 117
AI Summary: OriGene’s pCMV6-AC-GFP Vector expressing mouse SOCS1 was used to transiently transfect HEK293 cells, enabling the study of SOCS1’s role and its mutations in regulating NF-κB activity in response to NOS1-derived nitric oxide.
Snippet: … Cells were transiently transfected with pCMV6-AC-GFP Vector (OriGene), which expresses SOCS1 (mouse;available from GenBank under accession no. NM_009896.2) driven by the constitutive CMV promoter, using Lipofectamine 2000 reagent according to the manufacturer’s protocol. Cysteine mutations (C147S, C179S, C43S, C78S and C112S) were introduced in SOCS1 ORF (GenScript USA Inc.)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products