OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cd74 (NM_010545) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR225627
Cd74 (Myc-DDK-tagged) - Mouse CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) (Cd74), transcript variant 2
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA386130 Recombinant Anti-CD74 (Clone In-1)
200 ug
$770.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Cd74 or NM_010545"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cd74
Synonyms CLIP; DHLAG; HLADG; Ia-GAMMA; Ii
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR225627 representing NM_010545
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGACCAACGCGACCTCATCTCTAACCATGAACAGTTGCCCATACTGGGCAACCGCCCTAGAGAGC
CAGAAAGGTGCAGCCGTGGAGCTCTGTACACCGGTGTCTCTGTCCTGGTGGCTCTGCTCTTGGCTGGGCA
GGCCACCACTGCTTACTTCCTGTACCAGCAACAGGGCCGCCTAGACAAGCTGACCATCACCTCCCAGAAC
CTGCAACTGGAGAGCCTTCGCATGAAGCTTCCGAAATCTGCCAAACCTGTGAGCCAGATGCGGATGGCTA
CTCCCTTGCTGATGCGTCCAATGTCCATGGATAACATGCTCCTTGGGCCTGTGAAGAACGTTACCAAGTA
CGGCAACATGACCCAGGACCATGTGATGCATCTGCTCACGAGGTCTGGACCCCTGGAGTACCCGCAGCTG
AAGGGGACCTTCCCAGAGAATCTGAAGCATCTTAAGAACTCCATGGATGGCGTGAACTGGAAGATCTTCG
AGAGCTGGATGAAGCAGTGGCTCTTGTTTGAGATGAGCAAGAACTCCCTGGAGGAGAAGAAGCCCACCGA
GGCTCCACCTAAAGAGCCACTGGACATGGAAGACCTATCTTCTGGCCTGGGAGTGACCAGGCAGGAACTG
GGTCAAGTCACCCTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR225627 representing NM_010545
Red=Cloning site Green=Tags(s)

MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLAGQATTAYFLYQQQGRLDKLTITSQN
LQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQL
KGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQEL
GQVTL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_010545
ORF Size 645 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010545.3, NP_034675.1
RefSeq Size 1239 bp
RefSeq ORF 648 bp
Locus ID 16149
UniProt ID Q545Y5
Cytogenetics 18 34.41 cM
MW 24.9 kDa
Summary Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place. Enhance also the stimulation of T-cell responses through interaction with CD44.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_010545" in other vectors (3)
SKU Description Size Price
MG225627 Cd74 (tGFP-tagged) - Mouse CD74 antigen (invariant polypeptide of major histocompatibility complex class II antigen-associated) (Cd74) transcript variant 2, (10ug) 10 ug
$500.00
MR225627L3 Lenti ORF clone of Cd74 (Myc-DDK-tagged) - Mouse CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) (Cd74), transcript variant 2 10 ug
$600.00
MR225627L4 Lenti ORF clone of Cd74 (mGFP-tagged) - Mouse CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) (Cd74), transcript variant 2 10 ug
$600.00

Plasmid Map for MR225627

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR225627
Circular map for MR225627

file-alt Citations

The E3 ubiquitin ligase RNF114 and TAB1 degradation are required for maternal-to-zygotic transition
Yang, Zhou, Wang et al
EMBO Rep. (2017)
AI Summary: OriGene contributed to this study by providing expression plasmids for human or mouse Rnf114 and thirteen substrate proteins (including Flag-Appl1, Flag-Optn, Flag-Tnip2, Flag-Tom1l2, Flag-Nek10, Flag-Ralgps1, Cd74, Dcn1, Epha1, Psat1, Rab3il1, Tab1, and Tnip1), which were used to investigate RNF114-mediated ubiquitination during the maternal-to-zygotic transition.
Snippet: The expression plasmids of human or mouse Rnf114 and the eukaryotic expression plasmids of 13 substrates, including Flag- Appl1, Flag-Optn, Flag-Tnip2, Flag-Tom1 l2, Flag-Nek10, Flag- Ralgps1, Cd74, Dcn1, Epha1, Psat1, Rab3il1, Tab1, and Tnip1, were purchased from OriGene
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products