OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Crkl (NM_007764) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR225132
Crkl (Myc-DDK-tagged) - Mouse v-crk sarcoma virus CT10 oncogene homolog (avian)-like (Crkl)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Crkl or NM_007764"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Crkl
Synonyms 1110025F07Rik; AA589403; AI325100; Cr; Crkol; snoop
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR225132 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTCCGCCAGGTTTGATTCTTCAGACCGCTCTGCCTGGTACATGGGGCCAGTGACTCGCCAGGAGG
CGCAGACTCGTCTCCAAGGCCAGCGCCATGGCATGTTCCTAGTCCGGGACTCATCTACCTGCCCCGGGGA
CTATGTACTGTCCGTGTCCGAGAACTCGCGTGTCTCGCACTACATCATCAACTCCCTGCCCAACCGCCGC
TTTAAGATCGGGGACCAGGAGTTTGACCATTTGCCGGCCTTGTTAGAGTTCTACAAGATCCACTACCTGG
ACACTACCACCTTAATCGAACCGGCGCCCAGGTACCCAAGCCCACCAGTGGGTTCTGTCTCAGCACCCAA
CTTACCTACAGCAGAAGAAAATCTGGAATATGTACGGACCCTTTATGATTTTCCTGGGAATGATGCTGAA
GACCTACCCTTTAAAAAGGGCGAGCTTCTAGTGATAATAGAAAAGCCTGAAGAGCAGTGGTGGAGTGCCC
GCAACAAGGACGGCCGGGTTGGGATGATTCCTGTCCCTTACGTTGAAAAGCTTGTGAGGTCTTCGCCACA
TGGAAAGCATGGAAATAGGAATTCTAACAGTTATGGCATCCCAGAACCTGCTCATGCGTATGCTCAACCT
CAGACCACAACTCCTCTACCTACAGTTGCCAGTACTCCTGGGGCAGCGATCAACCCTTTGCCATCCACAC
AGAATGGACCTGTCTTTGCAAAAGCAATCCAGAAGAGAGTACCTTGTGCTTATGACAAGACTGCCTTGGC
ATTGGAGGTTGGTGACATTGTGAAAGTCACAAGGATGAATATCAATGGCCAATGGGAAGGCGAGGTGAAT
GGGCGCAAGGGGCTTTTCCCCTTCACACATGTTAAAATCTTTGACCCTCAGAACCCCGATGACAACGAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR225132 protein sequence
Red=Cloning site Green=Tags(s)

MSSARFDSSDRSAWYMGPVTRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRR
FKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPVGSVSAPNLPTAEENLEYVRTLYDFPGNDAE
DLPFKKGELLVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQP
QTTTPLPTVASTPGAAINPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN
GRKGLFPFTHVKIFDPQNPDDNE

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007764
ORF Size 909 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007764.5, NP_031790.2
RefSeq Size 5050 bp
RefSeq ORF 912 bp
Locus ID 12929
UniProt ID P47941, A2RS58
Cytogenetics 16 A3
MW 33.8 kDa
Summary This gene is part of a family of adapter proteins that mediate formation of signal transduction complexes in response to extracellular stimuli, such as growth and differentiation factors. Protein-protein interactions occur through the SH2 domain, which binds phosphorylated tyrosine residues, and the SH3 domain, which binds proline-rich peptide motifs. These interactions promote recruitment and activation of effector proteins to regulate cell migration, adhesion, and proliferation. In certain mouse genetic backgrounds this protein is essential for embryonic development. It is important for neural crest cell differentiation and survival and is proposed to play an important role in transducing the oncogenic signal of Bcr/Abl. Deletion of this gene in mouse mimics the phenotype of DiGeorge/velocardiofacial syndrome in human. Alternative splicing results in multiple transcript variants that encode different protein isoforms. provided by RefSeq, Mar 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_007764" in other vectors (4)
SKU Description Size Price
MC208335 Crkl (untagged) - Mouse v-crk sarcoma virus CT10 oncogene homolog (avian)-like (Crkl), (10ug) 10 ug
$330.00
MG225132 Crkl (tGFP-tagged) - Mouse v-crk sarcoma virus CT10 oncogene homolog (avian)-like (Crkl), (10ug) 10 ug
$500.00
MR225132L3 Lenti ORF clone of Crkl (Myc-DDK-tagged) - Mouse v-crk sarcoma virus CT10 oncogene homolog (avian)-like (Crkl) 10 ug
$600.00
MR225132L4 Lenti ORF clone of Crkl (mGFP-tagged) - Mouse v-crk sarcoma virus CT10 oncogene homolog (avian)-like (Crkl) 10 ug
$600.00

Plasmid Map for MR225132

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR225132
Circular map for MR225132

file-alt Citations

Src-like adaptor protein 2 (SLAP2) binds to and inhibits FLT3 signaling
Moharram, Chougule, Su et al
Oncotarget (2016)
Cited by 17
AI Summary: OriGene contributed to this study by providing pCMV-Myc-FLAG plasmids encoding murine full-length SLAP2, VAV2, CRK, CRKL, ITK, TEC, and NCK2, which were used to investigate the interactions and regulatory effects of SH2 domain-containing proteins on FLT3 signaling.
Snippet: FLT3-Y591F, pcDNA3-FLT3- Y589/591F, pMSCVpuro-FLT3-WT and pMSCVpuro- FLT3-ITD plasmids were described elsewhere [7]. Murine full-length SLAP2, VAV2, CRK, CRKL, ITK, TEC and NCK2 plasmids in the pCMV-Myc-FLAG vector were obtained from Origene ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products