OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Eri1 (NM_026067) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR225061
Eri1 (Myc-DDK-tagged) - Mouse exoribonuclease 1 (Eri1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Eri1 or NM_026067"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Eri1
Synonyms 3'hexo; 3110010F15Rik; eri-1; Thex1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR225061 representing NM_026067
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGACGAGCGGGGCCGGGAGCGTGGCGGCGACGCGGCGCAGCAGAAGACGCCGCGGCCGGAGTGTG
AGGAGTCCCGGCCGCTGAGCGTGGAGAAAAAGCAGCGATGCAGACTTGATGGCAAAGAGACAGATGGATC
GAAGTTCATTTCCTCCAATGGCAGTGACTTCAGTGACCCGGTTTACAAAGAGATCGCAATGACAAACGGT
TGTATCAACCGGATGAGTAAGGAGGAACTCAGAGCTAAACTTTCAGAATTTAAGCTTGAAACAAGAGGAG
TCAAGGATGTTCTAAAGAAGAGACTGAAAAACTATTACAAGAAGCAGAAGTTGATGCTGAAAGAGAGCTC
CGCTGGGGACAGTTACTATGACTACATTTGTATCATTGACTTTGAGGCTACTTGTGAAGAGGGGAACCCA
GCTGAGTTCCTACATGAAATCATTGAGTTTCCTGTTGTCCTGTTGAATACACACACCTTAGAAATCGAAG
ATACGTTTCAGCAGTATGTGAGGCCAGAAGTCAATGATCAGCTTTCAGAGTTCTGCATCGGTCTTACTGG
AATCACTCAGGATCAGGTAGACAGAGCCGATGCTTTCCCTCAGGTCCTGAAAAAAGTGATTGAGTGGATG
AAGTCAAAGGAGTTGGGAACTAAGTACAAGTACTGTATACTAACAGATGGCTCCTGGGATATGAGTAAGT
TCCTGAGCATCCAGTGCCGGCTCAGCAGACTCAAACACCCGGCCTTCGCTAAGAAGTGGATCAATATCCG
GAAGTCATACGGAAACTTCTATAAGGTTCCCAGAAGCCAGACCAAACTAACAATAATGCTTGAAAAATTA
GGAATGGATTATGATGGACGGCCTCACAGCGGTCTCGATGACTCTAAGAACATTGCTAGAATAGCTATTC
GGATGCTTCAGGATGGATGTGAACTTCGAATCAATGAAAAAATACTTGGAGGGCAGTTGATGAGTGTGTC
CTCATCCTTACCAGTAGAGGGCGCTCCAGCTCCACAGATGCCACATAGTAGAAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR225061 representing NM_026067
Red=Cloning site Green=Tags(s)

MEDERGRERGGDAAQQKTPRPECEESRPLSVEKKQRCRLDGKETDGSKFISSNGSDFSDPVYKEIAMTNG
CINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESSAGDSYYDYICIIDFEATCEEGNP
AEFLHEIIEFPVVLLNTHTLEIEDTFQQYVRPEVNDQLSEFCIGLTGITQDQVDRADAFPQVLKKVIEWM
KSKELGTKYKYCILTDGSWDMSKFLSIQCRLSRLKHPAFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKL
GMDYDGRPHSGLDDSKNIARIAIRMLQDGCELRINEKILGGQLMSVSSSLPVEGAPAPQMPHSRK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_026067
ORF Size 1035 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026067.3, NP_080343.4
RefSeq Size 5067 bp
RefSeq ORF 1038 bp
Locus ID 67276
UniProt ID Q7TMF2
Cytogenetics 8 A4
MW 39.6 kDa
Summary RNA exonuclease that binds to the 3'-end of histone mRNAs and degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. A 2' and 3'-hydroxyl groups at the last nucleotide of the histone 3'-end is required for efficient degradation of RNA substrates. Also able to degrade the 3'-overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). Binds with high affinity to the 3' side of the stem-loop structure and to the downstream cleavage product (DCP) of histone pre-mRNAs. Requires for binding the 5'-ACCCA-3' sequence present in stem-loop structure. Able to bind other mRNAs (By similarity). Required for 5.8S rRNA 3'-end processing. Also binds to 5.8s ribosomal RNA.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_026067" in other vectors (4)
SKU Description Size Price
MC210515 Eri1 (untagged) - Mouse exoribonuclease 1 (Eri1), (10ug) 10 ug
$457.00
MG225061 Eri1 (tGFP-tagged) - Mouse exoribonuclease 1 (Eri1), (10ug) 10 ug
$657.00
MR225061L3 Lenti ORF clone of Eri1 (Myc-DDK-tagged) - Mouse exoribonuclease 1 (Eri1) 10 ug
$757.00
MR225061L4 Lenti ORF clone of Eri1 (mGFP-tagged) - Mouse exoribonuclease 1 (Eri1) 10 ug
$757.00

Plasmid Map for MR225061

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR225061
Circular map for MR225061

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products