OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ccnb1ip1 (NM_001111119) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR222573
Ccnb1ip1 (Myc-DDK-tagged) - Mouse cyclin B1 interacting protein 1 (Ccnb1ip1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA344340 Rabbit Polyclonal Anti-Ccnb1ip1 Antibody - N-terminal region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Ccnb1ip1 or NM_001111119"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ccnb1ip1
Synonyms Gm288; Hei10; mei4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR222573 representing NM_001111119
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTTGTGTGAAGACATGCTGCTTTGCAATTATCGGAAGTGTCGGATCAAGCTCTCTGGTTATGCTT
GGGTCACTGCCTGTTCTCACATCTTCTGCGATCAGCACGGCAGCGGGGAGTTCAGTCGTTCACCAGCGAT
CTGTCCTGCTTGCAACAGTACCCTTTCTGGAAAGCTAGATATTGTTCGAACAGAACTCAGTCCATCAGAG
GAGTACAAAGCTATGGTATTGGCAGGGCTTCGCCCAGAGGTTGTTTTGGACATTAGCTCCCGGGCATTGG
CCTTCTGGACATACCAGGTACACCAGGAGCGTCTCTATCAAGAGTATAATTTCAGCAAGGCCGAGAACCA
CTTAAAACAGATGGAGAAGATGTATATGCAGCAAATACAGAGCAAGAATATAGAATTGACCTCTATGAAA
GGGGAGGTTATTTCCATGAAGAAAGTTCTAGAAGAATACAAGAAAAAGTTTAGTGACATCTCTGAAAAAC
TTATGGAGCGTAATCGCCAGTACCAAAAGCTCCAAGGCCTTTATGATAGCCTTAGGCTAAGAAATATCAC
TATCGCCAGCCAAGAAGGCTCCCTGGAACCAGGTATGATCCCGCAGTCTGGAGTCTTTGGCTTCCCACCA
GGGAATAACTCAAAGTTTTCTTTGGACCATATACCAGTTGGAAATCAAGGTGGTGGAGATGAAGATGTTC
AGTTCAGACCATTTTTTGTGTGTTCTCCCACAGCGCCTGAACCCATTAACAACTTCTTTAGTTTTGCATC
TCCAAGCCATGAAGCAGAGCAGCAAGTCTGCAGCAGGGCCTTTAAAGCAAAAAGAATT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR222573 representing NM_001111119
Red=Cloning site Green=Tags(s)

MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSE
EYKAMVLAGLRPEVVLDISSRALAFWTYQVHQERLYQEYNFSKAENHLKQMEKMYMQQIQSKNIELTSMK
GEVISMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIASQEGSLEPGMIPQSGVFGFPP
GNNSKFSLDHIPVGNQGGGDEDVQFRPFFVCSPTAPEPINNFFSFASPSHEAEQQVCSRAFKAKRI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001111119
ORF Size 828 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001111119.1, NP_001104589.1
RefSeq Size 1508 bp
RefSeq ORF 831 bp
Locus ID 239083
UniProt ID D3Z3K2
Cytogenetics 14 C1
MW 31.8 kDa
Summary Ubiquitin E3 ligase that acts as a limiting factor for crossing-over during meiosis: required during zygonema to limit the colocalization of RNF212 with MutS-gamma-associated recombination sites and thereby establish early differentiation of crossover and non-crossover sites. Later, it is directed by MutL-gamma to stably accumulate at designated crossover sites. Probably promotes the dissociation of RNF212 and MutS-gamma to allow the progression of recombination and the implementation of the final steps of crossing over. Modulates cyclin-B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001111119" in other vectors (4)
SKU Description Size Price
MC213064 Ccnb1ip1 (untagged) - Mouse cyclin B1 interacting protein 1 (Ccnb1ip1), (10ug) 10 ug
$330.00
MG222573 Ccnb1ip1 (tGFP-tagged) - Mouse cyclin B1 interacting protein 1 (Ccnb1ip1), (10ug) 10 ug
$500.00
MR222573L3 Lenti ORF clone of Ccnb1ip1 (Myc-DDK-tagged) - Mouse cyclin B1 interacting protein 1 (Ccnb1ip1) 10 ug
$600.00
MR222573L4 Lenti ORF clone of Ccnb1ip1 (mGFP-tagged) - Mouse cyclin B1 interacting protein 1 (Ccnb1ip1) 10 ug
$600.00

Plasmid Map for MR222573

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR222573
Circular map for MR222573

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products