OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tnfsf9 (NM_009404) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR220933
Tnfsf9 (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 9 (Tnfsf9)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
$289.00 $450.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA386222 Recombinant Anti-4-1BBL (Clone AT113-2)
200 ug
$770.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Tnfsf9 or NM_009404"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tnfsf9
Synonyms 4-1BB-L; 4-1BBL; AI848817; Cd137l; Ly63l
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR220933 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCAGCACACACTTGATGTGGAGGATACCGCGGATGCCAGACATCCAGCAGGTACTTCGTGCCCCT
CGGATGCGGCGCTCCTCAGAGATACCGGGCTCCTCGCGGACGCTGCGCTCCTCTCAGATACTGTGCGCCC
CACAAATGCCGCGCTCCCCACGGATGCTGCCTACCCTGCGGTTAATGTTCGGGATCGCGAGGCCGCGTGG
CCGCCTGCACTGAACTTCTGTTCCCGCCACCCAAAGCTCTATGGCCTAGTCGCTTTGGTTTTGCTGCTTC
TGATCGCCGCCTGTGTTCCTATCTTCACCCGCACCGAGCCTCGGCCAGCGCTCACAATCACCACCTCGCC
CAACCTGGGTACCCGAGAGAATAATGCAGACCAGGTCACCCCTGTTTCCCACATTGGCTGCCCCAACACT
ACACAACAGGGCTCTCCTGTGTTCGCCAAGCTACTGGCTAAAAACCAAGCATCGTTGTGCAATACAACTC
TGAACTGGCACAGCCAAGATGGAGCTGGGAGCTCATACCTATCTCAAGGTCTGAGGTACGAAGAAGACAA
AAAGGAGTTGGTGGTAGACAGTCCCGGGCTCTACTACGTATTTTTGGAACTGAAGCTCAGTCCAACATTC
ACAAACACAGGCCACAAGGTGCAGGGCTGGGTCTCTCTTGTTTTGCAAGCAAAGCCTCAGGTAGATGACT
TTGACAACTTGGCCCTGACAGTGGAACTGTTCCCTTGCTCCATGGAGAACAAGTTAGTGGACCGTTCCTG
GAGTCAACTGTTGCTCCTGAAGGCTGGCCACCGCCTCAGTGTGGGTCTGAGGGCTTATCTGCATGGAGCC
CAGGATGCATACAGAGACTGGGAGCTGTCTTATCCCAACACCACCAGCTTTGGACTCTTTCTTGTGAAAC
CCGACAACCCATGGGAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR220933 protein sequence
Red=Cloning site Green=Tags(s)

MDQHTLDVEDTADARHPAGTSCPSDAALLRDTGLLADAALLSDTVRPTNAALPTDAAYPAVNVRDREAAW
PPALNFCSRHPKLYGLVALVLLLLIAACVPIFTRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNT
TQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTF
TNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGA
QDAYRDWELSYPNTTSFGLFLVKPDNPWE

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_009404
ORF Size 927 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009404.3, NP_033430.1
RefSeq Size 1230 bp
RefSeq ORF 930 bp
Locus ID 21950
UniProt ID P41274
Cytogenetics 17 D
MW 33.9 kDa
Summary Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_009404" in other vectors (4)
SKU Description Size Price
MC209555 Tnfsf9 (untagged) - Mouse tumor necrosis factor (ligand) superfamily, member 9 (Tnfsf9), (10ug) 10 ug
$450.00
MG220933 Tnfsf9 (tGFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily member 9 (Tnfsf9), (10ug) 10 ug
$489.00 $650.00
MR220933L3 Lenti ORF clone of Tnfsf9 (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 9 (Tnfsf9) 10 ug
$750.00
MR220933L4 Lenti ORF clone of Tnfsf9 (mGFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 9 (Tnfsf9) 10 ug
$750.00

Plasmid Map for MR220933

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR220933
Circular map for MR220933

file-alt Citations

Inclusion of Dap10 or 4-1BB costimulation domains in the chPD1 receptor enhances anti-tumor efficacy of T cells in murine models of lymphoma and melanoma
Kintz, Nylen, Barber
Cell. Immunol. (2020) 351, 104069 DOI: 10.1016/j.cellimm.2020.104069
Cited by 25
AI Summary: OriGene supplied murine cDNA clones of CD3ζ, PD1, CD28, Dap10, 4-1BB, GITR, ICOS, and OX40, which were used to generate the chimeric PD1 receptor constructs evaluated in this study.
Snippet: …Murine cDNA clones of CD3ζ, PD1, CD28, Dap10, 4-1BB, GITR, ICOS, OX40 were purchased from OriGene and constructed as previously described [32];- 2. …Murine cDNA clones of CD3ζ, PD1, CD28, Dap10, 4-1BB, GITR, ICOS, OX40 were purchased from OriGene and constructed as previously described [32]
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products