OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Awat2 (NM_177746) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR219385
Awat2 (Myc-DDK-tagged) - Mouse acyl-CoA wax alcohol acyltransferase 2 (Awat2)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Awat2 or NM_177746"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Awat2
Synonyms 9430062J17Rik; ARAT; Dgat2l4; WS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR219385 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCTGGCCCACCAAGAAGGACCTCAAGACCGCCATGGAGGTCTTTGCTCTTTTCCAGTGGGCCCTCA
GTGCCTTGGTTATAGTCACCACTGTGATCATTGTCAACCTCTACTTGGTGGTGTTCACATCTTACTGGCC
TGTCACCGTGTTGATGCTCACCTGGCTGGCTTTTGACTGGAAGACCCCTGAGCGAGGTGGCCGCAGGTTC
ACCTGTGTGAGGAAGTGGCGTCTGTGGAAACACTATAGCGACTACTTCCCACTCAAGATGGTGAAGACGA
AAGATATTTCACCTGACCGCAACTACATCCTTGTCTGCCATCCTCATGGGCTCATGGCCCATTCATGTTT
TGGTCACTTTGCCACTGACACAACAGGCTTTTCCAAGACCTTTCCTGGTATCACTCCTTATATGCTCACA
CTAGGAGCCTTTTTCTGGGTACCTTTCCTCAGAGATTATGTAATGTCTACAGGGTCGTGCTCTGTGAGTA
GATCCTCCATGGACTTTTTGCTTACCCAGAAGGGCACAGGCAACATGCTTGTGGTGGTGGTTGGTGGCCT
GGCTGAGTGCAGATACAGCACGCCAGGCTCTACCACCCTGTTCTTGAAGAAGCGGCAAGGCTTTGTGCGC
ACAGCCCTTAAACATGGGGTGTCTCTAATCCCAGCTTATGCCTTTGGAGAGACAGACCTCTATGACCAGC
ACATTTTCACTCCTGGGGGCTTTGTCAATCGCTTCCAGAAGTGGTTCCAGAAGATGGTACACATCTACCC
CTGTGCTTTCTATGGGCGTGGCCTCACCAAGAACTCCTGGGGCCTTCTGCCCTATTCTCAGCCAGTAACC
ACTGTTGTTGGAGAACCTCTACCATTGCCCAAGATTGAGAATCCGAGCGAGGAGATTGTGGCCAAATACC
ACACACTCTATATTGATGCCCTACGAAAATTGTTTGATCAGCATAAGACCAAGTTTGGCATCTCAGAGAC
CCAGGAGCTGGTGATAGTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR219385 protein sequence
Red=Cloning site Green=Tags(s)

MFWPTKKDLKTAMEVFALFQWALSALVIVTTVIIVNLYLVVFTSYWPVTVLMLTWLAFDWKTPERGGRRF
TCVRKWRLWKHYSDYFPLKMVKTKDISPDRNYILVCHPHGLMAHSCFGHFATDTTGFSKTFPGITPYMLT
LGAFFWVPFLRDYVMSTGSCSVSRSSMDFLLTQKGTGNMLVVVVGGLAECRYSTPGSTTLFLKKRQGFVR
TALKHGVSLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQKMVHIYPCAFYGRGLTKNSWGLLPYSQPVT
TVVGEPLPLPKIENPSEEIVAKYHTLYIDALRKLFDQHKTKFGISETQELVIV

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_177746
ORF Size 999 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_177746.4, NP_808414.2
RefSeq Size 1632 bp
RefSeq ORF 1002 bp
Locus ID 245532
UniProt ID Q6E1M8
Cytogenetics X C3
MW 38.1 kDa
Summary Acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. Has no activity using decyl alcohol and significantly prefers the C16 and C18 alcohols. May also have 2-acylglycerol O-acyltransferase (MGAT) and acyl-CoA:retinol acyltransferase (ARAT) activities, to catalyze the synthesis of diacylglycerols and retinyl esters; however this activity is unclear in vivo (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_177746" in other vectors (4)
SKU Description Size Price
MC213221 Awat2 (untagged) - Mouse acyl-CoA wax alcohol acyltransferase 2 (Awat2), (10ug) 10 ug
$503.00
MG219385 Awat2 (tGFP-tagged) - Mouse acyl-CoA wax alcohol acyltransferase 2 (Awat2), (10ug) 10 ug
$657.00
MR219385L3 Lenti ORF clone of Awat2 (Myc-DDK-tagged) - Mouse acyl-CoA wax alcohol acyltransferase 2 (Awat2) 10 ug
$757.00
MR219385L4 Lenti ORF clone of Awat2 (mGFP-tagged) - Mouse acyl-CoA wax alcohol acyltransferase 2 (Awat2) 10 ug
$757.00

Plasmid Map for MR219385

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR219385
Circular map for MR219385

file-alt Citations

Allosteric modulation of the substrate specificity of acyl-CoA wax alcohol acyltransferase 2 (AWAT2)
Arne, Widjaja-Adhi, Hughes et al
J. Lipid Res. (2017)
AI Summary: OriGene Technologies contributed to this study by providing the mouse AWAT2 cDNA (NCBI accession # NM_177746), which was used for expression of AWAT2 in yeast to investigate its substrate specificity and allosteric modulation.
Snippet: Expression of mouse AWAT2 in yeast - cDNA of mouse AWAT2 (NCBI accession # NM_177746) was purchased from OriGene Technologies. To prepare an expression vector, the cDNA was amplified by PCR using the following primer pair: forward - ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products