OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Serpina3g (NM_009251) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR216778
Serpina3g (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade A, member 3G (Serpina3g)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA363307 SERPINA3G Antibody - middle region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Serpina3g or NM_009251"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Serpina3g
Synonyms 2A2; AI119734; spi2; Spi2-1; Spi2/eb.1; Spi2A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR216778 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGGTGTCTCCCCTGCTGTCTTTGGCTGCCCAGATGTCACCCTGGGAAGGAACACTGCAGTCCGTG
AAGTACAAGAAAATGTCACATCAGTGGACAGTTTAACACTGGTCTCCAGCAACACTGACTTTGCCTTCAG
CCTCTACAGGAAGCTGGTTTTGAAGAATCCAGATGAAAATGTTGTCTTCTCCCCATTCAGCATCTGCACT
GCCTTGGCCCTCCTGTCCCTGGGAGCAAAGAGCAACACCCTGAAGGAAATCCTAGAAGGTCTCAAGTTCA
ACCTCACAGAGACCCCTGAACCAGACATCCACCAGGGCTTTAGGTACTTGCTAGACCTTCTCAGTCAGCC
AGGGAACCAGGTACAGATCAGCACAGGCAGTGCCCTGTTTATTGAAAAGCACCTACAGATCCTGGCAGAG
TTCAAGGAGAAGGCAAGGGCTCTGTACCAGGCTGAGGCCTTCACAGCAGATTTCCAGCAACCTCTCAAGG
CCACAAAGCTCATCAATGACTATGTGAGCAATCACACCCAGGGGAAGATCAAGCAACTCATCTCAGGCCT
GAAAGAGAGCATGTTGATGGTGCTGGTGAACTACATCTACTTTAAAGGCAAATGGAAGAACCCCTTTGAC
CCGAATGATACATTTAAGTCCGAGTTCTACTTGGATGAGAAGAGGTCTGTGATTGTGTCCATGATGAAAA
CTGGTTACCTGACGACACCCTACTTCCGGGATGAGGAGCTGTCCTGCACTGTGGTGGAGCTGAAGTACAC
AGGAAATGCCAGTGCCATGTTCATCCTCCCTGACCAGGGCAGGATGCAGCAGGTGGAAGCAAGCTTACAA
CCAGAGACCCTGAGGAAGTGGAAGAACTCTCTGAAGCCCAGGATGATACATGAGCTCCGCCTGCCCAAGT
TCTCCATCTCCACCGACTACAGCCTGGAGCACATCCTTCCTGAGTTGGGCATCAGGGAAGTCTTCTCCAC
ACAGGCTGACCTGTCTGCAATCACAGGAACCAAGGATCTGAGAGTCTCTCAGGTGGTCCACAAGGCTGTG
CTGGATGTGGCTGAGAAAGGCACAGAGGCTGCTGCTGCCACAGGAATGGCAGGTGTCGGATGTTGTGCAG
TTTTTGACTTTCTGGAAATATTTTTCAACAGGCCATTCCTGATGATTATCTCTGACACAAAAGCTCACAT
TGCCCTCTTTATGGCAAAAGTTACAAATCCAGAGAGATCTGAGAACTTCCCAAATGGTGAGGGTGCTTCT
TCCCAACGGCTGGAATCTAAGCGTTTATGTTTTGGTGATCCGCTATGCCTGATTGGACAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR216778 protein sequence
Red=Cloning site Green=Tags(s)

MAGVSPAVFGCPDVTLGRNTAVREVQENVTSVDSLTLVSSNTDFAFSLYRKLVLKNPDENVVFSPFSICT
ALALLSLGAKSNTLKEILEGLKFNLTETPEPDIHQGFRYLLDLLSQPGNQVQISTGSALFIEKHLQILAE
FKEKARALYQAEAFTADFQQPLKATKLINDYVSNHTQGKIKQLISGLKESMLMVLVNYIYFKGKWKNPFD
PNDTFKSEFYLDEKRSVIVSMMKTGYLTTPYFRDEELSCTVVELKYTGNASAMFILPDQGRMQQVEASLQ
PETLRKWKNSLKPRMIHELRLPKFSISTDYSLEHILPELGIREVFSTQADLSAITGTKDLRVSQVVHKAV
LDVAEKGTEAAAATGMAGVGCCAVFDFLEIFFNRPFLMIISDTKAHIALFMAKVTNPERSENFPNGEGAS
SQRLESKRLCFGDPLCLIGQ

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_009251
ORF Size 1320 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009251.2
RefSeq Size 2030 bp
RefSeq ORF 1323 bp
Locus ID 20715
UniProt ID Q5I2A0
Cytogenetics 12 E
MW 49.1 kDa
Summary Serine and cysteine protease inhibitor. Can inhibit lysosomal papain-like proteases including the cathepsins B, G, H, K, L and V. Ineffective against elastase, granzyme A, granzyme B, or caspases 3, 8 or 9. Inhibition of cytoplasmic cathepsin B following release from the lysosome may protect cells from apoptosis. This may facilitate the survival of progenitor T-cells and the subsequent development of long term memory CD8 T-cells.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_009251" in other vectors (4)
SKU Description Size Price
MC215804 Serpina3g (untagged) - Mouse serine (or cysteine) peptidase inhibitor, clade A, member 3G (Serpina3g), (10ug) 10 ug
$503.00
MG216778 Serpina3g (tGFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor clade A member 3G (Serpina3g), (10ug) 10 ug
$657.00
MR216778L3 Lenti ORF clone of Serpina3g (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade A, member 3G (Serpina3g) 10 ug
$757.00
MR216778L4 Lenti ORF clone of Serpina3g (mGFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade A, member 3G (Serpina3g) 10 ug
$757.00

Plasmid Map for MR216778

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR216778
Circular map for MR216778

file-alt Citations

Hippocampal delivery of neurotrophic factor-α1/carboxypeptidase E gene prevents neurodegeneration, amyloidosis, memory loss in Alzheimer's Disease male mice
Xiao, Yang, Sharma et al
Mol Psychiatry (2023)
Cited by 35
AI Summary: In this study, OriGene’s mouse Serpina3g plasmid (Cat # MR216778) was used to investigate the role of pro-survival proteins in the neuroprotective effects of NF-α1/CPE gene therapy in an Alzheimer's disease mouse model.
Snippet: Alzheimer's Disease (AD) is a prevalent neurodegenerative disease characterized by tau hyperphosphorylation, Aβ1-42 aggregation and cognitive dysfunction. Save;Plasmids expressing human or mouse CPE carrying a C-terminal V5 tag were constructed into pcDNA3.1 backbone by Genscript (Piscataway, NJ). Plasmids expressing mouse serpina3g was from Origene Technologies (Rockville, MD, Cat # MR216778)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products