OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Igh (BC085312) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR207738
Igh (Myc-DDK-tagged) - Mouse immunoglobulin heavy chain complex (cDNA clone MGC:102623 IMAGE:6530848)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Igh or BC085312"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Igh
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR207738 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGAGTGCTGATTCTTTTGTGGCTGTTCACAGCCTTTCCTGGTATCCTGTCTGATGTGCAGCTTCAGG
AGTCAGGACCTGACCTGGTGAAACCTTCTCAGTCACTTTCACTCACCTGCACTGTCACTGGCTACTCCAT
CACCAGTGGTTATGGCTGGCACTGGATCCGGCAGTTTCCAGGAAACAAACTGGAGTGGATGGGCTACATA
AGCTACAGTGGTAGCAATAACTACAACCCATCTCTCAAAAGTCGAATCTCTATCACTCGAGACACATCCA
AGAACCAGTTCTTCCTGCAGTTGAATTCTGTGACTACTGAGGACACAGCCACATATTACTGTGCAAGATA
TGAGGGTAACTACGACTATGCTATGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAGAGCCT
GCAAGAGAGCCCACCATCTACCCACTGACATTCCCACAAGCTCTGTCAAGTGACCCAGTGATAATCGGCT
GCCTGATTCATGATTACTTCCCTTCCGGCACGATGAATGTGACCTGGGGAAAGAGTGGGAAGGATATAAC
CACCGTAAACTTCCCACCTGCCCTGGCCTCTGGGGGACGGTACACCATGAGCAGCCAGTTGACCCTGCCA
GCTGTCGAGTGCCCAGAAGGAGAATCCGTGAAATGTTCCGTGCAACATGACTCTAACCCCGTCCAAGAAT
TGAACGTGAATTGCCCTGGTATCTGTTCTCCTCCTACTACTCCTCCTCCACCTTCCTGCCAGCCCAGCCT
GTCACTGCAGCGGCCAGCTCTTGAGGACCTGCTCCTGGGTTCAGATGCCAGCATCACATGTACTCTGAAT
GGCCTGAGAGATCCTGAGGGAGCTGTCTTCACCTGGGAGCCCTCCACTGGGAAGGATGCAGTGCAGAAGA
AAGCTGTGCAGAATTCCTGCGGCTGCTACAGTGTGTCCAGCGTCCTGCCTGGCTGTGCTGAGCGCTGGAA
CAGTGGCGCATCATTCAAGTGCACAGTTACCCATCCTGAGTCTGACACCTTAACTGGCACAATTGCCAAA
GTCACAGTGAACACCTTCCCACCCCAGGTCCACCTGCTACCGCCGCCGTCGGAGGAGCTGGCCCTGAATG
AGCTCGTGTCCCTGACATGCCTGGTGCGAGCTTTCAACCCTAAAGAAGTGCTGGTGCGATGGCTGCATGG
AAATGAGGAGCTGTCCCCAGAAAGCTACCTAGTGTTTGAGCCCCTAAAGGAGCCAGGCGAGGGAGCCACC
ACCTACCTGGTGACAAGCGTGTTGCGTGTATCAGCTGAAATCTGGAAACAGGGTGACCAGTACTCCTGCA
TGGTGGGCCACGAGGCCTTGCCCATGAACTTCACCCAGAAGACCATCGACCGTCTGTCGGGTAAACCCAC
CAATGTCAGCGTGTCTGTGATCATGTCAGAGGGAGATGGCATCTGCTAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR207738 protein sequence
Red=Cloning site Green=Tags(s)

MRVLILLWLFTAFPGILSDVQLQESGPDLVKPSQSLSLTCTVTGYSITSGYGWHWIRQFPGNKLEWMGYI
SYSGSNNYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCARYEGNYDYAMDYWGQGTSVTVSSEP
AREPTIYPLTFPQALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGRYTMSSQLTLP
AVECPEGESVKCSVQHDSNPVQELNVNCPGICSPPTTPPPPSCQPSLSLQRPALEDLLLGSDASITCTLN
GLRDPEGAVFTWEPSTGKDAVQKKAVQNSCGCYSVSSVLPGCAERWNSGASFKCTVTHPESDTLTGTIAK
VTVNTFPPQVHLLPPPSEELALNELVSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGAT
TYLVTSVLRVSAEIWKQGDQYSCMVGHEALPMNFTQKTIDRLSGKPTNVSVSVIMSEGDGICY

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC085312
ORF Size 1449 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC085312
RefSeq Size 1567 bp
RefSeq ORF 1451 bp
Locus ID 111507
Cytogenetics 12 F1-F2|12
MW 52.7 kDa
Summary Summary:Immunoglobulins recognize foreign antigens and initiate immune responses such as phagocytosis and the complement system. Each immunoglobulin molecule consists of two identical heavy chains and two identical light chains. This region represents the germline organization of the heavy chain locus. The locus includes V (variable), D (diversity), J (joining), and C (constant) segments. During B cell development, a recombination event at the DNA level joins a single D segment with a J segment; this partially rearranged D-J gene is then joined to a V segment. The rearranged V-D-J is then transcribed with the IGHM constant region; this transcript encodes a mu heavy chain. Later in development B cells generate V-D-J-Cmu-Cdelta pre-messenger RNA, which is alternatively spliced to encode either a mu or a delta heavy chain. Mature B cells in the lymph nodes undergo switch recombination, so that the V-D-J gene is brought in proximity to one of the IGHG, IGHA, or IGHE genes and each cell expresses either the gamma, alpha, or epsilon heavy chain. Recombination of many different V segments with several J segments provides a wide range of antigen recognition. Additional diversity is attained by junctional diversity, resulting from the random additional of nucleotides by terminal deoxynucleotidyltransferase, and by somatic hypermutation, which occurs during B cell maturation in the spleen and lymph nodes. The RefSeq represents the IGH locus from C57BL/6. Several V and D segments in C57BL/6 are known to be incapable of encoding a protein and are considered pseudogenes. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"BC085312" in other vectors (3)
SKU Description Size Price
MG207738 Igh (tGFP-tagged) - Mouse immunoglobulin heavy chain complex (cDNA clone MGC:102623 IMAGE:6530848) 10 ug
$657.00
MR207738L3 Lenti ORF clone of Igh (Myc-DDK-tagged) - Mouse immunoglobulin heavy chain complex (cDNA clone MGC:102623 IMAGE:6530848) 10 ug
$757.00
MR207738L4 Lenti ORF clone of Igh (mGFP-tagged) - Mouse immunoglobulin heavy chain complex (cDNA clone MGC:102623 IMAGE:6530848) 10 ug
$757.00

Plasmid Map for MR207738

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR207738
Circular map for MR207738

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products