OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cap1 (NM_007598) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR207594
Cap1 (Myc-DDK-tagged) - Mouse CAP, adenylate cyclase-associated protein 1 (yeast) (Cap1)
Interest in protein/lysate? Submit request here!
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA363003 CAP1 Antibody - middle region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Cap1 or NM_007598"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cap1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR207594 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGACATGCAAAATCTTGTAGAAAGATTGGAGAGGGCAGTGGGCCGCCTGGAGGCAGTGTCACATA
CTTCAGACATGCACTGTGGATATGGAGACAGCCCTTCAAAAGGAGCAGTTCCATATGTGCAAGCATTTGA
CTCGCTGCTTGCCAATCCCGTGGCAGAGTACTTGAAGATGAGTAAGGAGATCGGGGGAGATGTGCAGAAA
CACGCGGAGATGGTCCACACAGGCCTGAAGTTGGAGCGAGCTCTCCTGGCTACAGCTTCTCAGTGCCAGC
AGCCAGCTGGTAATAAACTTTCTGATTTGTTGGCACCTATCTCGGAGCAGATCCAAGAAGTTATAACCTT
CCGGGAGAAGAACCGAGGCAGCAAGTTTTTTAATCATCTATCTGCTGTCAGTGAAAGCATCCAGGCCTTG
GGCTGGGTGGCTCTGGCTGCGAAACCTGGCCCCTTTGTGAAAGAGATGAATGACGCGGCCATGTTTTACA
CAAATCGTGTCCTCAAGGAGTACAGAGATGTGGATAAGAAGCATGTGGACTGGGTCAGAGCTTACTTGAG
TATATGGACGGAGCTGCAGGCTTACATCAAGGAGTTTCATACTACTGGCCTGGCCTGGAGCAAGACGGGG
CCTGTGGCAAAAGAACTGAGTGGATTGCCATCTGGACCCTCTGTGGGATCAGGCCCACCTCCTCCCCCAC
CGGGCCCGCCTCCTCCCCCAATTCCTACCAGTTCTGGTTCTGACGACTCTGCATCACGCTCAGCACTGTT
TGCACAGATTAATCAGGGGGAAAGCATCACACATGCCCTGAAACATGTATCTGATGACATGAAGACTCAC
AAGAACCCTGCCCTGAAAGCTCAGAGCGGTCCAGTTCGGAGTGGCCCCAAACCATTCTCTGCACCTAAAC
CCCAAACTAGCCCCTCCCCCAAACCAGCCACAAAGAAGGAACCAGCTCTGCTGGAACTGGAAGGCAAGAA
ATGGAGAGTGGAAAACCAGGAGAATGTTTCTAACCTGGTGATTGATGACACTGAGCTGAAGCAGGTGGCT
TACATCTACAAGTGTGTCAACACAACATTGCAAATCAAGGGCAAAATTAACTCCATTACAGTAGATAACT
GTAAGAAGCTTGGCCTGGTGTTTGATGACGTGGTGGGCATTGTGGAGATAATCAATAGTAGGGATGTCAA
AGTTCAGGTGATGGGAAAAGTGCCAACCATTTCCATTAACAAAACAGATGGCTGCCATGCTTACCTGAGC
AAGAACTCCCTGGACTGTGAGATAGTCAGTGCCAAATCTTCTGAGATGAATGTCCTCATTCCTACCGAAG
GCGGTGATTTTAACGAGTTCCCAGTCCCCGAGCAGTTCAAGACCCTGTGGAACGGACAGAAGTTGGTCAC
CACAGTGACAGAAATCGCTGGA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR207594 protein sequence
Red=Cloning site Green=Tags(s)

MADMQNLVERLERAVGRLEAVSHTSDMHCGYGDSPSKGAVPYVQAFDSLLANPVAEYLKMSKEIGGDVQK
HAEMVHTGLKLERALLATASQCQQPAGNKLSDLLAPISEQIQEVITFREKNRGSKFFNHLSAVSESIQAL
GWVALAAKPGPFVKEMNDAAMFYTNRVLKEYRDVDKKHVDWVRAYLSIWTELQAYIKEFHTTGLAWSKTG
PVAKELSGLPSGPSVGSGPPPPPPGPPPPPIPTSSGSDDSASRSALFAQINQGESITHALKHVSDDMKTH
KNPALKAQSGPVRSGPKPFSAPKPQTSPSPKPATKKEPALLELEGKKWRVENQENVSNLVIDDTELKQVA
YIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHAYLS
KNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007598
ORF Size 1422 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007598.2
RefSeq Size 2749 bp
RefSeq ORF 1425 bp
Locus ID 12331
UniProt ID P40124
Cytogenetics 4 D2.2
MW 51.6 kDa
Summary The product of this gene plays a role in regulating actin dynamics by binding actin monomers and promoting the turnover of actin filaments. Reduced expression of this gene causes a reduction in actin filament turnover rates, causing multiple defects, including an increase in cell size, stress-fiber alterations, and defects in endocytosis and cell motility. A pseudogene of this gene is found on chromosome 14. Alternative splicing results in multiple transcript variants, but does not affect the protein. provided by RefSeq, Jul 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_007598" in other vectors (3)
SKU Description Size Price
MC205632 Cap1 (untagged) - Mouse CAP, adenylate cyclase-associated protein 1 (yeast) (Cap1), (10ug) 10 ug
$457.00
MR207594L3 Lenti ORF clone of Cap1 (Myc-DDK-tagged) - Mouse CAP, adenylate cyclase-associated protein 1 (yeast) (Cap1) 10 ug
$757.00
MR207594L4 Lenti ORF clone of Cap1 (mGFP-tagged) - Mouse CAP, adenylate cyclase-associated protein 1 (yeast) (Cap1) 10 ug
$757.00

Plasmid Map for MR207594

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR207594
Circular map for MR207594

file-alt Citations

miRNA mediated downregulation of cyclase-associated protein 1 (CAP1) is required for myoblast fusion
Singh, Rai, Weber et al
Front Cell Dev Biol (2022) 10, 899917 DOI: 10.3389/fcell.2022.899917
Cited by 3
AI Summary: OriGene’s CAP1 cDNA clone (CAT#: MR207594) was used in this study to enable overexpression experiments that investigated the role of CAP1 in myoblast fusion and skeletal muscle formation.
Snippet: event during myoblast fusion into myotubes. Materials and methods Plasmids and reagents Primers for qRT-PCR and sgRNA are listed in Supplementary Table S1. The cDNA clone for Cap1 was purchased from Origene (CAT#: MR207594) and subsequently cloned into lentiviral vector pLVX-puro (Clontech, Mountain View, United States). For overexpression of the candidate miRNAs, mirVana mimics (Thermo Fisher) w
FigureFigureFigure
miRNA mediated downregulation of non-muscle Cyclase associated protein 1 is required for myogenic differentiation
Singh, Rai, Weber et al
bioRxiv (2021)
Snippet: The cDNA clone for Cap1 was purchased from Origene (CAT#: MR207594) and subsequently cloned into lentiviral vector pLVX-puro (Clontech, Mountain View, USA). For overexpression of the candidate miRNAs, mirVana mimics (Thermo Fisher) were used
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products