OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tfap2c (NM_009335) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR207174
Tfap2c (Myc-DDK-tagged) - Mouse transcription factor AP-2, gamma (Tcfap2c), transcript variant 1
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA328193 M Tfap2c Antibody (N-term)
400 ul
$645.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Tfap2c or NM_009335"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tfap2c
Synonyms AA409384; Ap-2.2; AP2gamma; Stra2; Tcfap2c
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR207174 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGTGGAAAATAACAGATAATGTCAAGTATGAAGAGGATTGCGAGGATCGCCACGACTCGAGCAGTA
ATGGCAACCCTCGCATCCCTCACCTCTCCTCTCCCGGACAACATCTCTACAGTCCCGCGCCGCCTCTCTC
GCACACCGGGGTTGCAGAGTACCAGCCGCCTCCTTACTTCCCGCCGCCTTACCAGCAGCTGGCATACTCG
CAGTCCGCCGACCATTACTCGCATCTGGGAGAGGCTTACGCTGCCGCCATGAACCCCCTGCACCAGCCTG
CGGCCACCGGCAGCCAGCAACAGGCCTGGCCGGGTCGACAGAGTCAGGAGGGCTCTAGCCTGGCCTCGCA
CCACAGCCGCTCTGCAAGTCTAATACCCCATATTTCAGGGCTGGAGGGGGGCTCGGTGAGCGCCCGGCGG
GAAGTCTACCGCCGGTCCGACCTGCTGCTGCCTCACGCGCACGCCCTGGAAGCCGGCCTGGCTGAGAACC
TGGGGCTGCACGAGATGGCTCACCCCATAGAGGAGGTGCAGAATGTGGACGACGCGCACTTGCTCCTACA
CGATCAGACTGTCATTCGCAAAGGACCCATTTCGATGACCAAGAACCCTTTGGGGCTCCCTTGCCAGAAG
GACCTGGTGGGAGTGGTCATGAACCCCAGTGAGGTCTTCTGCTCAGTCCCTGGAAGACTGTCCCTGCTCA
GCTCCACGTCGAAGTACAAAGTAACTGTGGCTGAGGTACAGAGGCGACTGTCACCACCGGAATGCCTAAA
CGCCTCGCTCCTGGGAGGTGTGCTCAGAAGAGCAAAGTCCAAAAATGGAGGCCGGTCCTTGAGGGAGAAG
TTGGACAAAATTGGATTGAACCTTCCGGCCGGGAGACGGAAAGCTGCCCACGTCACTCTCCTCACGTCTC
TCGTGGAAGGTGAAGCCGTCCACCTAGCACGGGACTTTGCCTATGTCTGCGAAGCTGAGTTCCCTAGTAA
AGCGGTGGCTGACTATTTAACGAGACCACATCTTGGGGGACGGAATGAGATGGCCACGCGGAAGAGTATG
TTGTTGGCTGCACAGCAGGTGTGCAAGGAGTTCACTGACCTTCTCCATCAAGATCGGACACCCAACGGGA
ACAACAGGCCCGCCCAGGTCTTGGAGCCGAACATACAAAACTGTTTGTCTCATTTCAGCCTGATAACTCA
TGGCTTTGGCAGCCAGGCCATCTGTGCGGCGGTCTCCGCAGTGCAGAATTATATCAAGGAGGCTCTAATC
GCCATCGATAAGTCCTACATGAACCCGGGGGACCAGAGTCCGGCTGATTCCAGCAAGACGATGGAGAAAA
TGGAAAAGCACAGGAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR207174 protein sequence
Red=Cloning site Green=Tags(s)

MLWKITDNVKYEEDCEDRHDSSSNGNPRIPHLSSPGQHLYSPAPPLSHTGVAEYQPPPYFPPPYQQLAYS
QSADHYSHLGEAYAAAMNPLHQPAATGSQQQAWPGRQSQEGSSLASHHSRSASLIPHISGLEGGSVSARR
EVYRRSDLLLPHAHALEAGLAENLGLHEMAHPIEEVQNVDDAHLLLHDQTVIRKGPISMTKNPLGLPCQK
DLVGVVMNPSEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREK
LDKIGLNLPAGRRKAAHVTLLTSLVEGEAVHLARDFAYVCEAEFPSKAVADYLTRPHLGGRNEMATRKSM
LLAAQQVCKEFTDLLHQDRTPNGNNRPAQVLEPNIQNCLSHFSLITHGFGSQAICAAVSAVQNYIKEALI
AIDKSYMNPGDQSPADSSKTMEKMEKHRK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_009335
ORF Size 1347 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009335.1, NM_009335.2, NP_033361.1
RefSeq Size 2853 bp
RefSeq ORF 1350 bp
Locus ID 21420
UniProt ID Q61312
Cytogenetics 2 H3
MW 49.1 kDa
Summary Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_009335" in other vectors (3)
SKU Description Size Price
MG207174 Tfap2c (tGFP-tagged) - Mouse transcription factor AP-2, gamma (Tcfap2c) 10 ug
$657.00
MR207174L3 Lenti ORF clone of Tfap2c (Myc-DDK-tagged) - Mouse transcription factor AP-2, gamma (Tcfap2c), transcript variant 1 10 ug
$757.00
MR207174L4 Lenti ORF clone of Tfap2c (mGFP-tagged) - Mouse transcription factor AP-2, gamma (Tcfap2c), transcript variant 1 10 ug
$757.00

Plasmid Map for MR207174

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR207174
Circular map for MR207174

file-alt Citations

Glycolysis-Independent Glucose Metabolism Distinguishes TE from ICM Fate during Mammalian Embryogenesis
Chi, Sharpley, Nagaraj et al
Dev. Cell (2020) 53 (1), 9-26.e4 DOI: 10.1016/j.devcel.2020.02.015
Cited by 197
AI Summary: In this study, OriGene products pCMV6-Yap1, pCMV6-Tead4, and pCMV6-Tfap2c were used to express key transcription factors, enabling the investigation of their roles in trophectoderm (TE) fate specification during early mammalian embryogenesis.
Snippet: Skip to article;pGEMHE-mCherry-mTrim21 Addgene Cat #105522 pCMV6-Yap1 OriGene Cat #MR226049 pCMV6-Tead4 (ATT) OriGene Cat #MR219506 pCMV6-Tfap2c OriGene Cat #MR207174 pCMV6-Flag-Yap1 This paper N/A pCMV6-Myc-Tead4 (ATG) This paper N/A pQCMV-GFP-Tfap2c This paper N/A
Metabolic Regulation of Preimplantation Mouse Embryo Development
Chi
Thesis (2020)
Snippet: pGEMHE-mCherry-mTrim21 Addgene Cat #105522 pCMV6-Yap1 OriGene Cat #MR226049 pCMV6-Tead4 (ATT) OriGene Cat #MR219506 pCMV6-Tfap2c OriGene Cat #MR207174 pCMV6-Flag-Yap1 This lab N/A pCMV6-Myc-Tead4 (ATG) This lab N/A pQCMV-GFP-Tfap2c This lab N/A
Transcriptional control of apical protein clustering drives de novo cell polarity establishment in the early mouse embryo
Zhu, Wang, Handford et al
bioRxiv (2020)
Cited by 3
Snippet: kidney cDNA and cloned into the pRN3p vector. To construct pRN3p-Tfap2c, Tfap2c cDNA was purchased from Origene (MR207174) and cloned into the pRN3p vector. pRN3p-Cas9 was a gift of J. Na (Tsinghua University, School of Medicine). Ezrin-Ruby
Glucose metabolism distinguishes TE from ICM fate during mammalian embryogenesis
Chi, Sharpley, Nagaraj et al
bioRxiv (2019)
Snippet: GFP mRNA (TriLink #L-7201), pGEMHE-mCherry-mTrim21 (Addgene #105522), pCMV6-YAP1 (OriGene #MR219506), pCMV6-TEAD4 (OriGene #MR219506) and pCMV6-AP-2γ (Origene #MR207174)
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products