OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Kcnk2 (BC062094) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR206535
Kcnk2 (Myc-DDK-tagged) - Mouse potassium channel, subfamily K, member 2 (cDNA clone MGC:69619 IMAGE:6848897)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Kcnk2 or BC062094"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Kcnk2
Synonyms A430027H14Rik; AI848635; TREK-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR206535 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTGCAGTGGCGGCCCCTGACTTGCTGGATCCCAAGTCTGCTGCTCAGAACTCCAAACCGAGGCTCT
CATTCTCCTCAAAACCCACCGTGCTTGCTTCCCGGGTGGAGAGTGACTCGGCCATTAATGTTATGAAATG
GAAGACAGTCTCCACGATTTTCCTGGTGGTCGTCCTCTACCTGATCATCGGAGCCACGGTGTTCAAGGCA
TTGGAGCAGCCTCAGGAGATTTCCCAGAGGACCACCATTGTGATCCAGAAGCAGACCTTCATAGCCCAGC
ATGCCTGCGTCAACTCCACCGAGCTGGACGAACTCATCCAGCAAATAGTGGCAGCAATAAACGCAGGGAT
TATCCCCTTAGGAAACAGCTCCAATCAAGTTAGTCACTGGGACCTCGGAAGCTCTTTCTTCTTTGCTGGT
ACTGTTATCACAACCATAGGATTTGGAAACATCTCCCCACGAACTGAAGGTGGAAAAATATTCTGCATCA
TCTATGCCTTGCTGGGAATTCCCCTCTTTGGCTTTCTACTGGCTGGGGTTGGTGATCAGCTAGGAACTAT
ATTTGGAAAAGGAATTGCCAAAGTGGAAGACACATTTATTAAGTGGAATGTTAGTCAGACGAAGATTCGT
ATCATCTCCACCATCATCTTCATCCTGTTTGGCTGTGTCCTCTTTGTGGCTCTCCCTGCGGTCATATTCA
AGCACATAGAAGGCTGGAGCGCCCTGGACGCTATCTATTTTGTGGTTATCACTCTGACGACCATTGGATT
TGGAGACTACGTGGCAGGTGGATCAGACATTGAATATCTGGACTTCTACAAGCCTGTGGTGTGGTTCTGG
ATCCTCGTTGGGCTGGCCTACTTTGCAGCTGTTCTGAGCATGATTGGGGACTGGCTACGGGTGATCTCTA
AGAAGACGAAGGAAGAGGTGGGAGAGTTCAGAGCGCATGCCGCTGAGTGGACAGCCAATGTCACGGCCGA
GTTCAAGGAAACGAGGAGGCGGCTGAGCGTGGAGATCTACGACAAGTTCCAGCGTGCCACATCCGTGAAG
CGGAAGCTCTCCGCAGAGCTGGCGGGCAACCACAACCAGGAACTGACTCCGTGTAGGAGGACCCTGTCTG
TGAACCACCTGACCAGCGAGAGGGAAGTCCTGCCTCCCTTGCTGAAGGCTGAGAGCATCTATCTGAACGG
TCTGACACCACACTGTGCTGGTGAGGACATAGCTGTCATTGAGAACATGAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR206535 protein sequence
Red=Cloning site Green=Tags(s)

MGAVAAPDLLDPKSAAQNSKPRLSFSSKPTVLASRVESDSAINVMKWKTVSTIFLVVVLYLIIGATVFKA
LEQPQEISQRTTIVIQKQTFIAQHACVNSTELDELIQQIVAAINAGIIPLGNSSNQVSHWDLGSSFFFAG
TVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIR
IISTIIFILFGCVLFVALPAVIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFW
ILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSVK
RKLSAELAGNHNQELTPCRRTLSVNHLTSEREVLPPLLKAESIYLNGLTPHCAGEDIAVIENMK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC062094
ORF Size 1242 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC062094, AAH62094
RefSeq Size 3228 bp
RefSeq ORF 1244 bp
Locus ID 16526
Cytogenetics 1 H6
MW 45.6 kDa
Summary Ion channel that contributes to passive transmembrane potassium transport. Reversibly converts between a voltage-insensitive potassium leak channel and a voltage-dependent outward rectifying potassium channel in a phosphorylation-dependent manner. In astrocytes, forms mostly heterodimeric potassium channels with KCNK1, with only a minor proportion of functional channels containing homodimeric KCNK2 (PubMed:24496152). In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1 (PubMed:24496152).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"BC062094" in other vectors (4)
SKU Description Size Price
MC217713 Kcnk2 (untagged) - Mouse potassium channel, subfamily K, member 2 (cDNA clone MGC:69619 IMAGE:6848897), (10ug) 10 ug
$503.00
MG206535 Kcnk2 (tGFP-tagged) - Mouse potassium channel, subfamily K, member 2 (cDNA clone MGC:69619 IMAGE:6848897) 10 ug
$489.00 $657.00
MR206535L3 Lenti ORF clone of Kcnk2 (Myc-DDK-tagged) - Mouse potassium channel, subfamily K, member 2 (cDNA clone MGC:69619 IMAGE:6848897) 10 ug
$757.00
MR206535L4 Lenti ORF clone of Kcnk2 (mGFP-tagged) - Mouse potassium channel, subfamily K, member 2 (cDNA clone MGC:69619 IMAGE:6848897) 10 ug
$757.00

Plasmid Map for MR206535

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR206535
Circular map for MR206535

file-alt Citations

TMEM120A/TACAN inhibits mechanically activated PIEZO2 channels
Del Rosario, Gabrielle, Yudin et al
J Gen Physiol (2022) 154 (8) DOI: 10.1085/jgp.202213164
Cited by 30
AI Summary: OriGene products contributed to this study by providing myc-tagged mouse Tmem120A (MR205146), myc-tagged mouse Tmem120b (MR205067), and myc-tagged mouse Trek1 (KCNK2; MR206535) cDNA clones, which were used to investigate the regulatory effects of TMEM120A on PIEZO2 channel activity.
Snippet: cDNA constructs The Piezo1-IRES-GFP and the Piezo2 pcDNA clones were from Dr. Ardem Patapoutian, Scripps Research, San Diego, CA (Coste et al., 2010). The following cDNA clones were purchased from Origene: myc-tagged mouse Tmem120A (MR205146, NM_172541), myc-tagged mouse Tmem120b (MR205067, NM_001039723), and myc-tagged mouse Trek1 (KCNK2;MR206535, BC062094). The GFP-tagged Piezo1 construct (G
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products