OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Aurka (BC005425) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR206182
Aurka (Myc-DDK-tagged) - Mouse aurora kinase A (cDNA clone MGC:5804 IMAGE:3590706)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Aurka or BC005425"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Aurka
Synonyms IAK, Ark1, Ayk1, AIRK1, Aurora-A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR206182 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAGATGTAAAGAAAACTGTGTCTCCAGGCCTGTTAAGACCACTGTTCCCTTCGGTCCGAAACGCG
TCTTGGTGACTGAGCAGATTCCGTCTCAGAACCTAGGATCTGCTAGCAGTGGCCAGGCCCAGCGGGTCCT
GTGTCCTTCTAACTCTCAGCGTGTCCCTTCACAAGCCCAGAAACTTGGAGCAGGTCAGAAGCCGGCACCA
AAGCAGTTGCCAGCTGCCAGTGTTCCTCGGCCTGTGTCCCGGCTCAATAACCCCCAGAAGAATGAGCAGC
CTGCAGCCTCCGGAAATGATTCTGAAAAGGAGCAGGCATCCTTGCAGAAGACCGAAGACACAAAAAAAAG
GCAGTGGACTTTGGAAGATTTTGACATTGGCCGCCCACTAGGAAAAGGGAAGTTTGGAAATGTCTACTTG
GCGCGGGAGAGACAAAGCAAGTTCATCCTGGCTCTGAAGGTGCTGTTTAAAACACAGCTGGAGAAGGCGA
ACGTGGAGCACCAGCTTCGGAGAGAGGTGGAGATCCAGTCGCACCTGCGGCACCCCAACATCCTCAGGCT
GTATGGCTATTTCCATGACGCCACCCGAGTTTATCTGATTCTAGAATATGCGCCCCTTGGAACAGTCTAT
AGAGAGCTCCAAAAACTCTCCAAGTTTGACGAGCAGAGAACAGCTACTTACATCACTGAGTTGGCAAACG
CTCTGTCTTACTGTCATTCAAAGAGAGTGATCCACAGAGACATTAAGCCAGAGAACTTACTGCTTGGCTC
AAACGGAGAGTTGAAGATTGCAGACTTCGGGTGGTCGGTGCATGCTCCATCTTCCAGGAGAACCACAATG
TGTGGCACCCTGGACTACCTGCCCCCAGAGATGATTGAAGGCCGGATGCATGACGAGAAGGTGGACCTCT
GGAGCCTGGGCGTTCTCTGCTATGAGTTCCTAGTGGGGATGCCTCCTTTCGAGGCACACACGTACCAGGA
GACTTACAGAAGGATATCTCGGGTTGAATTCACTTTCCCTGACTTTGTGACAGAGGGAGCCAGGGACCTC
ATTTCAAGACTGTTAAAACACAACGCAAGCCAAAGGCTAACACTAGCGGAAGTCCTTGAGCACCCTTGGA
TCAAAGCTAATTCTTCCAAACCTCCAACTGGCCACACTAGCAAAGAGCCAACCAGCAAATCATCT

ACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGA
TTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR206182 protein sequence
Red=Cloning site Green=Tags(s)

MDRCKENCVSRPVKTTVPFGPKRVLVTEQIPSQNLGSASSGQAQRVLCPSNSQRVPSQAQKLGAGQKPAP
KQLPAASVPRPVSRLNNPQKNEQPAASGNDSEKEQASLQKTEDTKKRQWTLEDFDIGRPLGKGKFGNVYL
ARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVY
RELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTM
CGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDL
ISRLLKHNASQRLTLAEVLEHPWIKANSSKPPTGHTSKEPTSKSS

TRPLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-NotI Cloning Scheme for this gene | Plasmid Map
ACCN BC005425
ORF Size 1185 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC005425, AAH05425
RefSeq Size 1850 bp
RefSeq ORF 1187 bp
Locus ID 20878
Cytogenetics 2 94.84 cM
MW 44.8 kDa
Summary Mitotic serine/threonine kinase that contributes to the regulation of cell cycle progression. Associates with the centrosome and the spindle microtubules during mitosis and plays a critical role in various mitotic events including the establishment of mitotic spindle, centrosome duplication, centrosome separation as well as maturation, chromosomal alignment, spindle assembly checkpoint, and cytokinesis. Required for normal spindle positioning during mitosis and for the localization of NUMA1 and DCTN1 to the cell cortex during metaphase (By similarity). Required for initial activation of CDK1 at centrosomes. Phosphorylates numerous target proteins, including ARHGEF2, BORA, BRCA1, CDC25B, DLGP5, HDAC6, KIF2A, LATS2, NDEL1, PARD3, PPP1R2, PLK1, RASSF1, TACC3, p53/TP53 and TPX2. Regulates KIF2A tubulin depolymerase activity. Required for normal axon formation. Plays a role in microtubule remodeling during neurite extension. Important for microtubule formation and/or stabilization. Also acts as a key regulatory component of the p53/TP53 pathway, and particularly the checkpoint-response pathways critical for oncogenic transformation of cells, by phosphorylating and stabilizing p53/TP53. Phosphorylates its own inhibitors, the protein phosphatase type 1 (PP1) isoforms, to inhibit their activity. Necessary for proper cilia disassembly prior to mitosis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"BC005425" in other vectors (4)
SKU Description Size Price
MC217751 Aurka (untagged) - Mouse aurora kinase A (cDNA clone MGC:5804 IMAGE:3590706), (10ug) 10 ug
$503.00
MG206182 Aurka (tGFP-tagged) - Mouse aurora kinase A (cDNA clone MGC:5804 IMAGE:3590706) 10 ug
$489.00 $657.00
MR206182L3 Lenti ORF clone of Aurka (Myc-DDK-tagged) - Mouse aurora kinase A (cDNA clone MGC:5804 IMAGE:3590706) 10 ug
$757.00
MR206182L4 Lenti ORF clone of Aurka (mGFP-tagged) - Mouse aurora kinase A (cDNA clone MGC:5804 IMAGE:3590706) 10 ug
$757.00

Plasmid Map for MR206182

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR206182
Circular map for MR206182

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products