OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Pofut1 (NM_080463) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR206140
Pofut1 (Myc-DDK-tagged) - Mouse protein O-fucosyltransferase 1 (Pofut1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Pofut1 or NM_080463"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Pofut1
Synonyms mKIAA0180; O-FucT-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR206140 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCGCCGCCGCGTGGGCACCGCCACACCTGCTGCTGCGGGCGTCTTTCCTGCTTCTGCTGCTGTTGC
TGCCGCTCCGCGGGCGGTCAGCGGGCTCCTGGGACCTGGCCGGTTACCTGCTCTACTGTCCCTGCATGGG
GCGCTTTGGGAACCAGGCTGATCACTTCTTGGGCTCCCTGGCATTTGCGAAGCTGCTGAACCGCACCTTG
GCTGTACCTCCATGGATTGAATACCAACATCACAAGCCTCCTTTCACCAACCTCCATGTGTCCTACCAAA
AGTACTTCAAACTGGAGCCTCTCCAAGCCTACCATCGGGTTGTCAGCCTGGAGGACTTCATGGAAAATCT
GGCACCCTCCCACTGGCCCCCTGAGAAGCGAGTGGCATACTGCTTTGAGGTGGCAGCCCAGCGAAGTCCT
GATAAGAAGACATGTCCCATGAAGGAAGGAAATCCTTTTGGGCCATTCTGGGACCAGTTTCATGTGAGTT
TCAATAAGTCAGAACTGTTCACAGGCATTTCCTTCAGCGCCTCCTACAAAGAACAATGGACCCAGAGATT
TCCTGCAAAAGAGCATCCTGTGCTCGCACTGCCTGGGGCCCCAGCACAGTTCCCTGTCCTGGAGGAACAC
AGGGAGCTCCAGAAGTACATGGTGTGGTCAGATGAGATGGTGAGGACGGGAGAGGCCCTGATCAGTGCCC
ACCTCGTCCGGCCCTATGTGGGCATTCATCTGCGCATTGGCTCCGACTGGAAGAATGCCTGTGCCATGCT
GAAGGATGGAACTGCAGGGTCACACTTCATGGCTTCCCCTCAGTGTGTGGGCTATAGCCGCAGCACAGCG
ACCCCTCTCACCATGACCATGTGCCTCCCTGACCTGAAGGAAATCCAGCGGGCTGTGACGCTTTGGGTGA
GAGCACTGAATGCCAGATCGGTCTACATCGCCACAGACTCTGAGAGCTACGTGTCAGAGATCCAGCAGCT
CTTCAAAGACAAGGTGAGGGTGGTGAGCCTGAAACCCGAGGTGGCCCAGATCGACCTGTACATCCTCGGC
CAGGCTGACCACTTCATTGGAAACTGTGTCTCCTCGTTCACTGCCTTCGTGAAGCGGGAGCGGGACCTCC
ATGGGAGGCAGTCGTCCTTCTTTGGCATGGACAGACCCTCCCAGCTTCGGGATGAATTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR206140 protein sequence
Red=Cloning site Green=Tags(s)

MGAAAWAPPHLLLRASFLLLLLLLPLRGRSAGSWDLAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTL
AVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVVSLEDFMENLAPSHWPPEKRVAYCFEVAAQRSP
DKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYKEQWTQRFPAKEHPVLALPGAPAQFPVLEEH
RELQKYMVWSDEMVRTGEALISAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTA
TPLTMTMCLPDLKEIQRAVTLWVRALNARSVYIATDSESYVSEIQQLFKDKVRVVSLKPEVAQIDLYILG
QADHFIGNCVSSFTAFVKRERDLHGRQSSFFGMDRPSQLRDEF

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_080463
ORF Size 1179 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080463.3, NP_536711.3
RefSeq Size 5618 bp
RefSeq ORF 1182 bp
Locus ID 140484
UniProt ID Q91ZW2
Cytogenetics 2 H1
MW 44.7 kDa
Summary Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue found in the consensus sequence C2-X(4,5)-S/T-C3 of EGF domains, where C2 and C3 are the second and third conserved cysteines. Specifically uses GDP-fucose as donor substrate and proper disulfide pairing of the substrate EGF domains is required for fucose transfer. Plays a crucial role in NOTCH signaling. Initial fucosylation of NOTCH by POFUT1 generates a substrate for FRINGE/RFNG, an acetylglucosaminyltransferase that can then extend the fucosylation on the NOTCH EGF repeats. This extended fucosylation is required for optimal ligand binding and canonical NOTCH signaling induced by DLL1 or JAGGED1. Fucosylates AGRN and determines its ability to cluster acetylcholine receptors (AChRs).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_080463" in other vectors (4)
SKU Description Size Price
MC203080 Pofut1 (untagged) - Mouse protein O-fucosyltransferase 1 (Pofut1), (10ug) 10 ug
$457.00
MG206140 Pofut1 (tGFP-tagged) - Mouse protein O-fucosyltransferase 1 (Pofut1), transcript variant 1 10 ug
$657.00
MR206140L3 Lenti ORF clone of Pofut1 (Myc-DDK-tagged) - Mouse protein O-fucosyltransferase 1 (Pofut1) 10 ug
$757.00
MR206140L4 Lenti ORF clone of Pofut1 (mGFP-tagged) - Mouse protein O-fucosyltransferase 1 (Pofut1) 10 ug
$757.00

Plasmid Map for MR206140

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR206140
Circular map for MR206140

file-alt Citations

Retention of DLK1 in the endoplasmic reticulum identifies roles for EGF domain-specific O-glycans in the secretory pathway
Tashima, Tsukamoto, Tsukamoto et al
bioRxiv (2024)
Snippet: d by the Trust Sanger Institute (UK) (59). Expression vectors for mouse Pofut1:MycDDK (#MR206140) and mouse Poglut1:MycDDK (#MR206123) were purchased from OriGene (MD, USA). The expression vector for human IgG-Fc has been described previously (34). The expression vector for mouse EOGT-IRES-GFP has been previously used (60). Plasmid constructs
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products