OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Mapkapk3 (NM_178907) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR205996
Mapkapk3 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase-activated protein kinase 3 (Mapkapk3)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Mapkapk3 or NM_178907"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Mapkapk3
Synonyms 3PK; AI874665; MAPKAP-K3; MAPKAP3; MapkKapk3; MK-3; MK3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR205996 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGGCGAGACAGCAGGGGAGAAGGGGAGTCTTGTGCCCCCGCCAGGTGCGCTCGGCGGGTCCGCCT
TGGGCGGTGCTCCGGCCCCAGGTGTGCGACGGGAACCCAAGAAGTACGCGGTGACTGATGACTACCAGTT
GTCCAAGCAAGTGCTGGGTCTGGGTGTGAACGGCAAGGTACTGGAGTGCTACCATCGGCGCTCTGGCCAG
AAGTGTGCCCTGAAGCTCCTGTATGACAGCCCCAAGGCCCGGCAGGAGGTGGACCACCACTGGCAGGCGT
CAGGCGGCCCCCACATCGTGCGCATCCTGGACGTGTATGAGAATATGCACCACGGCAAGCGCTGTCTCCT
CATCGTCATGGAATGCATGGAGGGTGGTGAGCTGTTCAGCAGGATTCAGGAGCGTGGTGACCAGGCTTTC
ACTGAGAGAGAGGCTGCAGAGATAATGCGGGACATTGGCACTGCCATCCAGTTCTTGCACAGCCGGAACA
TTGCCCACCGAGATGTCAAGCCTGAAAACCTACTCTATACATCCAAGGAGAAGGATGCTGTACTTAAACT
CACCGATTTTGGCTTTGCCAAGGAAACCACCCAAAATGCCCTCCAGACACCCTGCTACACTCCCTATTAT
GTGGCTCCTGAGGTCCTGGGTCCAGAGAAGTATGACAAGTCCTGTGATATGTGGTCCCTGGGCGTCATCA
TGTACATCCTTTTGTGTGGATTCCCACCCTTCTACTCCAACACCGGCCAGGCCATCTCTCCAGGAATGAA
AAGAAGGATTCGCTTGGGCCAGTATAGCTTCCCTAACCCTGAATGGTTAGATGTCTCTGAGGATGCCAAG
CAGCTAATCCGCCTGCTCCTGAAGACAGATCCCACAGAGAGGCTAACGATCATGCAGTTTATGAACCATC
CTTGGATCAATCAATCCATGGTGGTCCCACAGACCCCACTCTACACAGCCCGAGTGCTCCAGGAAGACAA
AGATCACTGGGATGACGTCAAGGAAGAGATGACCAGTGCCCTGGCCACTATGCGGGTAGACTATGACCAG
GTGAAGATCAAGGACCTGAAGACCTCTAACAACCGGCTCCTCAACAAGAGGAGGAAAAAGCAGGCAGGCA
GCTCCTCAGCCTCACAAGGATGCAACAACCAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR205996 protein sequence
Red=Cloning site Green=Tags(s)

MDGETAGEKGSLVPPPGALGGSALGGAPAPGVRREPKKYAVTDDYQLSKQVLGLGVNGKVLECYHRRSGQ
KCALKLLYDSPKARQEVDHHWQASGGPHIVRILDVYENMHHGKRCLLIVMECMEGGELFSRIQERGDQAF
TEREAAEIMRDIGTAIQFLHSRNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYY
VAPEVLGPEKYDKSCDMWSLGVIMYILLCGFPPFYSNTGQAISPGMKRRIRLGQYSFPNPEWLDVSEDAK
QLIRLLLKTDPTERLTIMQFMNHPWINQSMVVPQTPLYTARVLQEDKDHWDDVKEEMTSALATMRVDYDQ
VKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_178907
ORF Size 1152 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178907.2
RefSeq Size 2816 bp
RefSeq ORF 1155 bp
Locus ID 102626
UniProt ID Q3UMW7
Cytogenetics 9 F1
MW 43.3 kDa
Summary Stress-activated serine/threonine-protein kinase involved in cytokines production, endocytosis, cell migration, chromatin remodeling and transcriptional regulation. Following stress, it is phosphorylated and activated by MAP kinase p38-alpha/MAPK14, leading to phosphorylation of substrates. Phosphorylates serine in the peptide sequence, Hyd-X-R-X(2)-S, where Hyd is a large hydrophobic residue. MAPKAPK2 and MAPKAPK3, share the same function and substrate specificity, but MAPKAPK3 kinase activity and level in protein expression are lower compared to MAPKAPK2. Phosphorylates HSP27/HSPB1, KRT18, KRT20, RCSD1, RPS6KA3, TAB3 and TTP/ZFP36. Mediates phosphorylation of HSP27/HSPB1 in response to stress, leading to dissociate HSP27/HSPB1 from large small heat-shock protein (sHsps) oligomers and impair their chaperone activities and ability to protect against oxidative stress effectively. Involved in inflammatory response by regulating tumor necrosis factor (TNF) and IL6 production post-transcriptionally: acts by phosphorylating AU-rich elements (AREs)-binding proteins, such as TTP/ZFP36, leading to regulate the stability and translation of TNF and IL6 mRNAs. Phosphorylation of TTP/ZFP36, a major post-transcriptional regulator of TNF, promotes its binding to 14-3-3 proteins and reduces its ARE mRNA affinity leading to inhibition of dependent degradation of ARE-containing transcript. Involved in toll-like receptor signaling pathway (TLR) in dendritic cells: required for acute TLR-induced macropinocytosis by phosphorylating and activating RPS6KA3. Also acts as a modulator of Polycomb-mediated repression.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_178907" in other vectors (4)
SKU Description Size Price
MC204528 Mapkapk3 (untagged) - Mouse mitogen-activated protein kinase-activated protein kinase 3 (Mapkapk3), (10ug) 10 ug
$457.00
MG205996 Mapkapk3 (tGFP-tagged) - Mouse mitogen-activated protein kinase-activated protein kinase 3 (Mapkapk3) 10 ug
$657.00
MR205996L3 Lenti ORF clone of Mapkapk3 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase-activated protein kinase 3 (Mapkapk3) 10 ug
$757.00
MR205996L4 Lenti ORF clone of Mapkapk3 (mGFP-tagged) - Mouse mitogen-activated protein kinase-activated protein kinase 3 (Mapkapk3) 10 ug
$757.00

Plasmid Map for MR205996

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR205996
Circular map for MR205996

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products