OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ndrg1 (NM_008681) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR205950
Ndrg1 (Myc-DDK-tagged) - Mouse N-myc downstream regulated gene 1 (Ndrg1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
$289.00 $686.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA362985 NDRG1 Antibody - middle region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Ndrg1 or NM_008681"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ndrg1
Synonyms CAP43; CMT4D; DRG1; HMSNL; Ndr1; Ndrl; NMSL; PROXY1; RTP; TDD5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR205950 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCGAGAGCTACATGACGTGGACCTCGCTGAGGTGAAGCCTCTGGTGGAAAAAGGGGAGAGCATCA
CTGGTCTCCTGCAAGAGTTCGATGTTCAGGAGCAGGATATTGAGACCCTACATGGCTCCCTGCATGTCAC
CCTGTGTGGGACCCCCAAGGGCAACCGTCCTGTCATCCTCACGTATCACGACATCGGCATGAACCACAAG
ACCTGCTACAACCCCCTCTTCAACTCTGAGGACATGCAGGAGATCACACAACATTTTGCTGTCTGCCATG
TGGATGCCCCTGGCCAACAGGATGGTGCCCCTTCCTTCCCAGTGGGGTACATGTACCCCTCAATGGATCA
GTTGGCTGAAATGCTTCCTGGAGTCCTTCACCAGTTTGGGCTCAAGAGTGTCATTGGCATGGGGACAGGA
GCTGGCGCCTACATCCTGACCCGCTTCGCACTCAACAACCCTGAGATGGTAGAGGGTCTCGTGCTCATGA
ATGTGAACCCCTGTGCTGAAGGCTGGATGGACTGGGCTGCCTCTAAGATCTCAGGATGGACCCAAGCCCT
GCCTGACATGGTGGTGTCCCACCTCTTCGGCAAGGAGGAGATACACAACAACGTGGAGGTAGTGCACACG
TACCGCCAGCACATCCTCAACGACATGAACCCGAGCAACCTACACTTATTCATCAGCGCCTACAACAGCC
GGAGAGACCTGGAGATTGAGCGGCCAATGCCTGGAACCCACACTGTCACTTTGCAGTGCCCTGCTCTGCT
GGTAGTTGGAGACAACTCTCCTGCCGTGGATGCTGTGGTGGAATGCAATTCTAAATTGGACCCAACGAAG
ACCACCCTGCTCAAGATGGCAGACTGTGGAGGCCTTCCTCAGATCTCTCAGCCCGCCAAGCTTGCTGAGG
CCTTCAAGTACTTTGTGCAGGGCATGGGATACATGCCTTCTGCCAGCATGACTCGCCTGATGCGGTCCCG
CACAGCCTCTGGCTCCAGTGTCACATCCCTGGAGGGCACCCGTAGCCGCTCCCATACCAGCGAGGGCCCC
CGAAGCCGCTCGCACACCAGTGAGGGGTCCCGTAGCCGCTCCCATACCAGTGAGGATGCCCGTCTCAACA
TCACCCCCAACTCGGGTGCCACCGGAAACAATGCCGGGCCCAAGTCCATGGAGGTGTCCTGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR205950 protein sequence
Red=Cloning site Green=Tags(s)

MSRELHDVDLAEVKPLVEKGESITGLLQEFDVQEQDIETLHGSLHVTLCGTPKGNRPVILTYHDIGMNHK
TCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHQFGLKSVIGMGTG
AGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEIHNNVEVVHT
YRQHILNDMNPSNLHLFISAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDNSPAVDAVVECNSKLDPTK
TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLEGTRSRSHTSEGP
RSRSHTSEGSRSRSHTSEDARLNITPNSGATGNNAGPKSMEVSC

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_008681
ORF Size 1182 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_008681.2, NP_032707.2
RefSeq Size 2909 bp
RefSeq ORF 1185 bp
Locus ID 17988
UniProt ID Q62433
Cytogenetics 15 D2
MW 43 kDa
Summary Stress-responsive protein involved in hormone responses, cell growth, and differentiation. Acts as a tumor suppressor in many cell types. Necessary but not sufficient for p53/TP53-mediated caspase activation and apoptosis. Required for vesicular recycling of CDH1 and TF. May also function in lipid trafficking. Protects cells from spindle disruption damage. Functions in p53/TP53-dependent mitotic spindle checkpoint. Regulates microtubule dynamics and maintains euploidy (By similarity). Has a role in cell trafficking notably of the Schwann cell and is necessary for the maintenance and development of the peripheral nerve myelin sheath.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_008681" in other vectors (6)
SKU Description Size Price
MC203366 Ndrg1 (untagged) - Mouse N-myc downstream regulated gene 1 (Ndrg1), (10ug) 10 ug
$921.00
MG205950 Ndrg1 (tGFP-tagged) - Mouse N-myc downstream regulated gene 1 (Ndrg1) 10 ug
$489.00 $886.00
MR205950L1 Lenti ORF clone of Ndrg1 (Myc-DDK-tagged) - Mouse N-myc downstream regulated gene 1 (Ndrg1) 10 ug
$986.00
MR205950L2 Lenti ORF clone of Ndrg1 (mGFP-tagged) - Mouse N-myc downstream regulated gene 1 (Ndrg1) 10 ug
$986.00
MR205950L3 Lenti ORF clone of Ndrg1 (Myc-DDK-tagged) - Mouse N-myc downstream regulated gene 1 (Ndrg1) 10 ug
$986.00
MR205950L4 Lenti ORF clone of Ndrg1 (mGFP-tagged) - Mouse N-myc downstream regulated gene 1 (Ndrg1) 10 ug
$986.00

Plasmid Map for MR205950

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR205950
Circular map for MR205950

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products