OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Il1rap (NM_134103) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR205511
Il1rap (Myc-DDK-tagged) - Mouse interleukin 1 receptor accessory protein (Il1rap), transcript variant 2
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA363176 IL1RAP Antibody - C-terminal region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Il1rap or NM_134103"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Il1rap
Synonyms 6430709H04Rik; AI255955; AV239853; IL-1RAcP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR205511 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGACTTCTGTGGTATTTGATGAGTCTGTCCTTCTATGGGATCCTGCAGAGTCATGCTTCGGAGCGCT
GTGATGACTGGGGACTAGATACCATGCGACAAATCCAAGTGTTTGAAGATGAGCCGGCTCGAATCAAGTG
CCCCCTCTTTGAACACTTCCTGAAGTACAACTACAGCACTGCCCATTCCTCTGGCCTTACCCTGATCTGG
TACTGGACCAGGCAAGACCGGGACCTGGAGGAGCCCATTAACTTCCGCCTCCCAGAGAATCGCATCAGTA
AGGAGAAAGATGTGCTCTGGTTCCGGCCCACCCTCCTCAATGACACGGGCAATTACACCTGCATGTTGAG
GAACACAACTTACTGCAGCAAAGTTGCATTTCCCCTGGAAGTTGTTCAGAAGGACAGCTGTTTCAATTCT
GCCATGAGATTCCCAGTGCACAAGATGTATATTGAACATGGCATTCATAAGATCACATGTCCAAATGTAG
ACGGATACTTTCCTTCCAGTGTCAAACCATCGGTCACTTGGTATAAGGGTTGTACTGAAATAGTGGACTT
TCATAATGTACTACCCGAGGGCATGAACTTGAGCTTTTTCATCCCCTTGGTTTCAAATAACGGAAATTAC
ACATGTGTGGTTACATATCCTGAAAACGGACGTCTCTTTCACCTCACCAGGACTGTGACTGTAAAGGTGG
TGGGCTCACCAAAGGATGCATTGCCACCCCAGATCTATTCTCCAAATGACCGTGTTGTCTATGAGAAAGA
ACCAGGAGAGGAACTGGTTATTCCCTGCAAAGTCTATTTCAGTTTCATTATGGACTCCCACAATGAGGTC
TGGTGGACCATTGATGGAAAGAAGCCTGATGACGTCACAGTCGACATCACTATTAATGAAAGTGTAAGTT
ATTCTTCAACGGAAGATGAAACAAGGACTCAGATTTTGAGCATCAAGAAAGTCACCCCGGAGGATCTCAG
GCGCAACTATGTCTGTCATGCTCGAAATACCAAAGGGGAAGCTGAGCAGGCTGCCAAGGTGAAACAGAAA
GGTAATGGATGCACCGAGCCGATGACTCTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR205511 protein sequence
Red=Cloning site Green=Tags(s)

MGLLWYLMSLSFYGILQSHASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKYNYSTAHSSGLTLIW
YWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS
AMRFPVHKMYIEHGIHKITCPNVDGYFPSSVKPSVTWYKGCTEIVDFHNVLPEGMNLSFFIPLVSNNGNY
TCVVTYPENGRLFHLTRTVTVKVVGSPKDALPPQIYSPNDRVVYEKEPGEELVIPCKVYFSFIMDSHNEV
WWTIDGKKPDDVTVDITINESVSYSSTEDETRTQILSIKKVTPEDLRRNYVCHARNTKGEAEQAAKVKQK
GNGCTEPMTL

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_134103
ORF Size 1080 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_134103.2
RefSeq Size 2352 bp
RefSeq ORF 1083 bp
Locus ID 16180
UniProt ID Q61730
Cytogenetics 16 B2
MW 41.6 kDa
Summary Coreceptor for IL1RL2 in the IL-36 signaling system. Coreceptor with IL1R1 in the IL-1 signaling system. Associates with IL1R1 bound to IL1B to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Recruits TOLLIP to the signaling complex. Does not bind to interleukin-1 alone; binding of IL1RN to IL1R1, prevents its association with IL1R1 to form a signaling complex. The cellular response is modulated through a non-signaling association with the membrane IL1R2 decoy receptor. Secreted forms (isoforms 2 and 3) associate with secreted ligand-bound IL1R2 and increase the affinity of secreted IL1R2 for IL1B; this complex formation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors. Coreceptor for IL1RL1 in the IL-33 signaling system. Can bidirectionally induce pre- and postsynaptic differentiation of neurons by trans-synaptically binding to PTPRD (PubMed:25908590). May play a role in IL1B-mediated costimulation of IFNG production from T-helper 1 (Th1) cells (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_134103" in other vectors (3)
SKU Description Size Price
MG205511 Il1rap (tGFP-tagged) - Mouse interleukin 1 receptor accessory protein (Il1rap), transcript variant 2 10 ug
$657.00
MR205511L3 Lenti ORF clone of Il1rap (Myc-DDK-tagged) - Mouse interleukin 1 receptor accessory protein (Il1rap), transcript variant 2 10 ug
$757.00
MR205511L4 Lenti ORF clone of Il1rap (mGFP-tagged) - Mouse interleukin 1 receptor accessory protein (Il1rap), transcript variant 2 10 ug
$757.00

Plasmid Map for MR205511

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR205511
Circular map for MR205511

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products