OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cd300lf (NM_145634) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR204865
Cd300lf (Myc-DDK-tagged) - Mouse CD300 antigen like family member F (Cd300lf), transcript variant 2
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Cd300lf or NM_145634"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cd300lf
Synonyms CLIM1; CLM-1; CLM1; Digr2; F730004D16Rik; IgSF13; IREM1; LMIR3; Pigr3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204865 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCATTTGTCATTGCTGGTCCCCTTTCTCTTCTGGATCACAGGCTGCTGCACGGCTGAGGATCCAGTCA
CAGGTCCAGAGGAGGTGAGCGGTCAGGAGCAGGGCTCCTTGACAGTGCAGTGCCGATATACCTCAGGCTG
GAAGGATTACAAGAAGTACTGGTGCCAAGGAGTTCCTCAGAGATCATGTAAGACTCTTGTTGAAACCGAT
GCATCAGAGCAGCTGGTGAAGAAGAACCGTGTGTCCATCAGGGACAACCAGAGAGACTTCATCTTCACAG
TGACCATGGAGGATCTGAGGATGAGCGATGCTGGCATTTACTGGTGTGGAATTACGAAAGGTGGACTTGA
TCCCATGTTTAAAGTTACTGTGAACATTGGCCCAGTGCCAACCATGCCCCCCATCACCTCCACCACCACC
ATCTTCACAGTGACAACCACAGTAAAAGAGACCAGCATGTTTCCAACGCTGACTAGCTACTACTCTGATA
ACGGGCATGGCGGTGGTGACAGTGGCGGTGGTGAAGATGGCGTCGGTGATGGGTTTCTGGATCTCAGTGT
GCTCCTCCCAGTCATCTCTGCAGTCCTGTTGCTTCTCCTGTTGGTGGCCTCGCTCTTTGCTTGGAGGATG
GTGAGGAGACAGAAGAAAGCTGCTGGGCCACCATCAGAGCAGGCACAGTCTCTGGAGGGTGATCTCTGTT
ATGCAGACCTGTCCCTGAAGCAGCCCAGAACCTCCCCTGGCTCCTCTTGGAAAAAGGGCTCCTCCATGTC
CTCCTCTGGCAAGGACCACCAAGAGGAAGTGGAATATGTCACCATGGCTCCCTTTCCCAGGGAGGAGGTT
TCATATGCCGCTCTGACTTTGGCCGGCTTGGGTCAGGAGCCTACTTATGGCAATACTGGCTGCCCCATCA
CCCACGTTCCCAGGACAGGCCTTGAAGAGGAGACCACAGAGTACAGCAGCATCAGGAGGCCCTTGCCTGC
AGCCATGCCT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR204865 protein sequence
Red=Cloning site Green=Tags(s)

MHLSLLVPFLFWITGCCTAEDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLVETD
ASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDPMFKVTVNIGPVPTMPPITSTTT
IFTVTTTVKETSMFPTLTSYYSDNGHGGGDSGGGEDGVGDGFLDLSVLLPVISAVLLLLLLVASLFAWRM
VRRQKKAAGPPSEQAQSLEGDLCYADLSLKQPRTSPGSSWKKGSSMSSSGKDHQEEVEYVTMAPFPREEV
SYAALTLAGLGQEPTYGNTGCPITHVPRTGLEEETTEYSSIRRPLPAAMP

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_145634
ORF Size 990 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145634.3
RefSeq Size 1864 bp
RefSeq ORF 993 bp
Locus ID 246746
UniProt ID Q6SJQ7
Cytogenetics 11 E2
MW 36 kDa
Summary Acts as an inhibitory receptor for myeloid cells and mast cells (PubMed:17438331). Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is expressed on the surface of apoptotic cells (PubMed:21865548). Plays an important role in the maintenance of immune homeostasis, by promoting macrophage-mediated efferocytosis and by inhibiting dendritic cell-mediated efferocytosis (PubMed:26768664). Negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses via binding to ceramide which acts as a ligand (PubMed:23123064). May act as a coreceptor for interleukin 4 (IL-4). Associates with and regulates IL-4 receptor alpha-mediated responses by augmenting IL-4- and IL-13-induced signaling (PubMed:26124135). Negatively regulates the Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through activation of PTPN6/SHP-1 and PTPN11/SHP-2 (By similarity). Inhibits osteoclast formation (PubMed:14662855). Induces macrophage cell death upon engagement (PubMed:18097021).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_145634" in other vectors (4)
SKU Description Size Price
MC204586 Cd300lf (untagged) - Mouse CD300 antigen like family member F (Cd300lf), transcript variant 2, (10ug) 10 ug
$300.00
MG204865 Cd300lf (tGFP-tagged) - Mouse CD300 antigen like family member F (Cd300lf) 10 ug
$489.00 $500.00
MR204865L3 Lenti ORF clone of Cd300lf (Myc-DDK-tagged) - Mouse CD300 antigen like family member F (Cd300lf), transcript variant 2 10 ug
$600.00
MR204865L4 Lenti ORF clone of Cd300lf (mGFP-tagged) - Mouse CD300 antigen like family member F (Cd300lf), transcript variant 2 10 ug
$600.00

Plasmid Map for MR204865

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR204865
Circular map for MR204865

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products