OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Slc25a26 (NM_026255) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR203671
Slc25a26 (Myc-DDK-tagged) - Mouse solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 26 (Slc25a26), nuclear gene encoding mitochondrial protein
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Slc25a26 or NM_026255"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Slc25a26
Synonyms 4930433D19Rik; 4933433F13Rik; AW557176; D6Bwg0781e; Slc25a6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203671 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGCGCCGGGCTTCACGGCCTCGCTGGTGGCTGGAGGGGTAGCAGGCGTCTCTGTGGACTTGATAT
TATTTCCTCTGGACACCATTAAGACAAGGCTGCAGAGTCCCCAGGGATTTAACAAGGCTGGTGGATTTCG
TGGGATATATGCTGGGGTCCCTTCTGCAGCTGTTGGATCCTTTCCTAACGCTGCTGCATTTTTTCTCACC
TATGAATATGTGAAATCTTTGCTGCACACGGACTCTACTTCACACTTCAAACCCGTGAAGCACATGCTGG
CTGCCTCTACAGGAGAAGTGGTGGCCTGCTTGATTCGAGTTCCTTCTGAAGTGGTTAAGCAGAGGGCACA
GGTGTCTGCTTCTTCAAAGACCTTGCAGATCTTTTTGACTATCTTAAGTGAAGAGGGCATTCAAGGACTG
TACCGAGGCTATAAAAGCACAGTTTTAAGAGAGATTCCTTTCTCCTTGGTCCAGTTTCCCTTGTGGGAAT
CCTTGAAAGCCCTCTGGGCGTGGCGGCGGGGTCATGTGGTGGATTCTTGGCAGTCAGCAGTCTGCGGAGC
TTTTGCAGGTGGCTTTGCAGCTGCAGTGACTACACCTCTGGACGTGGCTAAGACAAGGATCATGCTGGCA
AAGGCGGGTTCCAGCACTGCTGTGGGGAACGTGCTCTCTGCCATGCACGGGGTGTGGCGCTCACAGGGAC
TAGCCGGGTTATTCGCAGGTGTCCTCCCGAGGATGGCAGCAATCAGCATGGGCGGCTTCATCTTTCTGGG
CGCCTATGACCAGGCGCGAAGCTTGCTGTTAGAGGTGGGCAGGAAGAGCCCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR203671 protein sequence
Red=Cloning site Green=Tags(s)

MDAPGFTASLVAGGVAGVSVDLILFPLDTIKTRLQSPQGFNKAGGFRGIYAGVPSAAVGSFPNAAAFFLT
YEYVKSLLHTDSTSHFKPVKHMLAASTGEVVACLIRVPSEVVKQRAQVSASSKTLQIFLTILSEEGIQGL
YRGYKSTVLREIPFSLVQFPLWESLKALWAWRRGHVVDSWQSAVCGAFAGGFAAAVTTPLDVAKTRIMLA
KAGSSTAVGNVLSAMHGVWRSQGLAGLFAGVLPRMAAISMGGFIFLGAYDQARSLLLEVGRKSP

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_026255
ORF Size 822 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026255.5
RefSeq Size 1933 bp
RefSeq ORF 825 bp
Locus ID 67582
UniProt ID Q5U680
Cytogenetics 6 D2
MW 29 kDa
Summary Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Specifically mediates the transport of S-adenosylmethionine (SAM) into the mitochondria (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_026255" in other vectors (4)
SKU Description Size Price
MC205979 Slc25a26 (untagged) - Mouse solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 26 (Slc25a26), nuclear gene encoding mitochondrial protein, (10ug) 10 ug
$300.00
MG203671 Slc25a26 (tGFP-tagged) - Mouse solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 26 (Slc25a26) 10 ug
$500.00
MR203671L3 Lenti ORF clone of Slc25a26 (Myc-DDK-tagged) - Mouse solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 26 (Slc25a26), nuclear gene encoding mitochondrial protein 10 ug
$600.00
MR203671L4 Lenti ORF clone of Slc25a26 (mGFP-tagged) - Mouse solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 26 (Slc25a26), nuclear gene encoding mitochondrial protein 10 ug
$600.00

Plasmid Map for MR203671

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR203671
Circular map for MR203671

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products