OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Lair1 (NM_001113474) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR203475
Lair1 (Myc-DDK-tagged) - Mouse leukocyte-associated Ig-like receptor 1 (Lair1), transcript variant a
Interest in protein/lysate? Submit request here!
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Lair1 or NM_001113474"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Lair1
Synonyms 5133400O11Rik; BB115266; D7Bwg0421e; Lair-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203475 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCACTTCATCCAGTTATCCTGCTGGTGCTTGTGCTGTGCCTGGGATGGAAAATTAACACACAGGAGG
GTTCTCTGCCTGATATTACCATCTTCCCTAATTCAAGTCTTATGATCTCCCAAGGGACTTTTGTAACTGT
TGTGTGCTCATACTCTGATAAACACGACTTGTATAACATGGTCCGCCTGGAGAAGGACGGCAGCACCTTT
ATGGAAAAGAGCACTGAGCCTTATAAAACAGAGGATGAATTTGAGATTGGGCCAGTGAATGAAACCATTA
CTGGACATTATAGCTGTATCTATTCGAAGGGGATTACCTGGTCCGAACGTAGTAAGACGCTGGAGCTAAA
GGTGATCAAAGAAAATGTCATCCAGACTCCTGCCCCAGGTCCAACCTCAGATACATCTTGGCTAAAGACA
TACAGCATTTACATTTTTACTGTGGTCTCTGTGATTTTCCTCCTTTGTCTTTCCGCCCTTCTGTTCTGCT
TCCTCAGGCACCGTCAGAAAAAGCAGGGACTCCCAAACAACAAAAGACAGCAGCAGAGGCCAGAAGAGAG
GCTAAATCTAGCTACTAATGGCCTGGAGATGACTCCAGACATAGTTGCAGATGACAGGCTTCCTGAGGAC
AGATGGACAGAAACCTGGACCCCAGTTGCAGGAGACCTTCAAGAGGTGACGTATATCCAGCTGGACCATC
ACTCCCTCACACAGAGGGCAGTCGGAGCTGTGACCTCACAGAGCACAGATATGGCTGAGTCCAGCACATA
TGCAGCCATCATCAGACGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR203475 protein sequence
Red=Cloning site Green=Tags(s)

MSLHPVILLVLVLCLGWKINTQEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTF
MEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKT
YSIYIFTVVSVIFLLCLSALLFCFLRHRQKKQGLPNNKRQQQRPEERLNLATNGLEMTPDIVADDRLPED
RWTETWTPVAGDLQEVTYIQLDHHSLTQRAVGAVTSQSTDMAESSTYAAIIRR

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001113474
ORF Size 789 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001113474.1, NP_001106945.1
RefSeq Size 3512 bp
RefSeq ORF 792 bp
Locus ID 52855
UniProt ID Q8BG84
Cytogenetics 7 2.31 cM
MW 29.8 kDa
Summary Functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of natural killer (NK) cells, B-cells and T-cells. Activation by Tyr phosphorylation results in recruitment and activation of the phosphatases PTPN6 and PTPN11. It also reduces the increase of intracellular calcium evoked by B-cell receptor ligation. May also play its inhibitory role independently of SH2-containing phosphatases. Modulates cytokine production in CD4+ T-cells, down-regulating IL2 and IFNG production while inducing secretion of transforming growth factor beta. Down-regulates also IgG and IgE production in B-cells as well as IL8, IL10 and TNF secretion. Inhibits proliferation and induces apoptosis in myeloid leukemia cell lines as well as prevents nuclear translocation of NF-kappa-B p65 subunit/RELA and phosphorylation of I-kappa-B alpha/CHUK in these cells. Inhibits the differentiation of peripheral blood precursors towards dendritic cells (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001113474" in other vectors (3)
SKU Description Size Price
MC207497 Lair1 (untagged) - Mouse leukocyte-associated Ig-like receptor 1 (Lair1), transcript variant a, (10ug) 10 ug
$300.00
MR203475L3 Lenti ORF clone of Lair1 (Myc-DDK-tagged) - Mouse leukocyte-associated Ig-like receptor 1 (Lair1), transcript variant a 10 ug
$600.00
MR203475L4 Lenti ORF clone of Lair1 (mGFP-tagged) - Mouse leukocyte-associated Ig-like receptor 1 (Lair1), transcript variant a 10 ug
$600.00

Plasmid Map for MR203475

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR203475
Circular map for MR203475

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products