OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Olig1 (NM_016968) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR203390
Olig1 (Myc-DDK-tagged) - Mouse oligodendrocyte transcription factor 1 (Olig1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA309204 Rabbit Anti-Olig1 Antibody
100 ul
$610.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Olig1 or NM_016968"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Olig1
Synonyms AI836478; AW494459; Bhlhb6; bHLHe21; Olg-1; Oligo1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203390 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACTATGCGATTTCCCAGGCGCGTGTGAACGCGGCTCCCGCGACCATGTTGCGGCCACAGCGGCCTG
GAGACGTGCAGCTCGGGGCCTCGCTGTATGAGCTGGTGGGTTACAGGCAGCCACCTATCTCCTCATCCTC
ATCCTCATCCTCTTCCACCGCATCCCTTCTCCCCAAGCCTGCGCGCGAGAAGGCCGAAGCTCCGCTCGCT
GAACCTCGGGGACCTGCGCCAGAGTCCGGGGGCGCCCGGGCCGACGCCAAAGAGGAACAGCAGCAGCAGC
AGCTGCGGCGCAAGATCAACAGCCGCGAGCGGAAGCGCATGCAGGACCTGAACTTGGCCATGGACGCGCT
GCGCGAAGTTATCCTACCCTACTCGGCAGCGCACTGCCAGGGCGCGCCGGGCCGCAAGCTCTCCAAGATT
GCCACGCTGCTGCTCGCCCGCAACTACATCCTGCTGCTGGGTAGCTCGCTGCAGGAGCTGCGCCGCGCGC
TCGGCGACGGTGCGGGACCCGCCGCCCCGCGCCTGCTCCTCGCTGGCCTGCCTCTTCTGGCTGCCGCGCC
GGGCTCTGTGCTGCTGGCACCCGGTGCCGTGGGACCCCCCGAAACGCTGCGCCCCACCAAGTACCTGTCT
CTAGCGCTCGACGAGCCACCGTGCGGCCAGTTCTCTCTCCCAGCTGGTGGCGCGGGTAGCCCTGGCCTCT
GCTCCTGTGCGGTGTGCAAGTTCCCGCATCTGGTCCCCGCCGGCCTGGGCTTGGCAGCGGTGCAGGCCCA
GTTCTCCAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR203390 protein sequence
Red=Cloning site Green=Tags(s)

MYYAISQARVNAAPATMLRPQRPGDVQLGASLYELVGYRQPPISSSSSSSSSTASLLPKPAREKAEAPLA
EPRGPAPESGGARADAKEEQQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKI
ATLLLARNYILLLGSSLQELRRALGDGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPETLRPTKYLS
LALDEPPCGQFSLPAGGAGSPGLCSCAVCKFPHLVPAGLGLAAVQAQFSK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_016968
ORF Size 780 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016968.4, NP_058664.2
RefSeq Size 2171 bp
RefSeq ORF 783 bp
Locus ID 50914
UniProt ID Q9JKN5
Cytogenetics 16 C3.3
MW 27.1 kDa
Summary Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_016968" in other vectors (3)
SKU Description Size Price
MG203390 Olig1 (tGFP-tagged) - Mouse oligodendrocyte transcription factor 1 (Olig1) 10 ug
$500.00
MR203390L3 Lenti ORF clone of Olig1 (Myc-DDK-tagged) - Mouse oligodendrocyte transcription factor 1 (Olig1) 10 ug
$600.00
MR203390L4 Lenti ORF clone of Olig1 (mGFP-tagged) - Mouse oligodendrocyte transcription factor 1 (Olig1) 10 ug
$600.00

Plasmid Map for MR203390

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR203390
Circular map for MR203390

file-alt Citations

RPRD1B/CREPT facilitates the progression of diffuse large B-cell lymphoma by inhibiting apoptosis through the NF-κB signaling pathway
Xu, Xie, Li et al
Asian Pacific Journal of Tropical Biomedicine (2024) 14 (7), 307-317 DOI: 10.4103/apjtb.apjtb_172_24
Cited by 1
AI Summary: OriGene products contributed to this study by providing specific primers for Bcl-2 and cIAP1, which were used to analyze gene expression related to apoptosis in diffuse large B-cell lymphoma.
Snippet: EPT cDNA was amplified utilizing primers: forward TATAGGTACCATGTCCTCCTTCTCTGAG and reverse TATACTCGAGCTAGT CAGTTGAAAACAGGTC. Primers for Bcl-2 and cIAP1 were purchased from OriGene (Bcl-2 forward ATCGCCCTGTGGATGACTGAGT and reverse GCCAGGAGAAATCAAACAGAGGC;cIAP1 forward CAGACACATGCAGCTCGAATGAG and reverse CACCTCAAGCCACCATCACAAC). The following antibodies were used for Western blotting: RPRD1B antibo...
RNF220-mediated K63-linked polyubiquitination stabilizes Olig proteins during oligodendroglial development and myelination
Li, Wan, Song et al
Sci Adv (2024) 10 (6), eadk3931 DOI: 10.1126/sciadv.adk3931
Cited by 12
AI Summary: OriGene's mouse Olig1 cDNA construct (MR203390) was used to study the role of Olig1 in oligodendroglial development and myelination in this research.
Snippet: from Ceshi Chen’s lab. Olig2 expression plasmid was a gift from Y. Li’s laboratory (Shanghai Jiao Tong University School of Medicine). The construct containing mouse Olig1 cDNA was purchased from OriGene (MR203390). RNF220 constructs were used as previously described (18). To prepare the Olig1 and Olig2 KR mutation constructs, site-directed mutagenesis was carried out by PCR-driven overlap ex
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products