OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cptp (NM_024472) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR202392
Gltpd1 (Myc-DDK-tagged) - Mouse glycolipid transfer protein domain containing 1 (Gltpd1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Cptp or NM_024472"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cptp
Synonyms Gltpd1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202392 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGACTCAGAGAAAGATTTCAACCTTAAAGTCGTCCTGGTCAGCTTCAAGCAGTGTCTCACTGACA
AGGGAGAGGTGCTGCTGGACCACTATATTGCCGGCTGGAAGGGACTTGTCAGGTTTCTAAACAGCCTGGG
GGCTGTCTTCTCATTCATTTCCAAGGATGTGGTCGCAAAGCTGCAGATCATGGAGCGTCTGAGAAGCAGC
CCACAGTCTGAACACTACACTAGCTTGCAGTCCATGGTAGCCTACGAGGTGAGCAACAAGCTGGTGGACA
TGGATCACCGTTCCCATCCCCGACACCCTCACTCAGGCTGCCGGACTGTGCTGCGCCTACATCGTGCTCT
GCACTGGCTACAGCTGTTCCTGGATGGCCTGCGCACCAGCTCTGAGGATGCTCGTACCTCCACACTCTGC
AGTGAGGCCTACAATGCCACGCTGGCTAACTATCACTCCTGGATAGTACGTCAAGCTGTCACTGTGGCCT
TCTGTGCCTTACCCTCACGCAAGGTCTTCCTCGAGGCCATGAATATGGAGTCCACTGAGCAAGCAGTGGA
GATGCTGGGGGAGGCCCTGCCCTTCATTGAGCATGTGTATGACATCTCCCAGAAGCTCTATGCTGAGCAT
TCCCTGCTAGACCTGCCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR202392 protein sequence
Red=Cloning site Green=Tags(s)

MDDSEKDFNLKVVLVSFKQCLTDKGEVLLDHYIAGWKGLVRFLNSLGAVFSFISKDVVAKLQIMERLRSS
PQSEHYTSLQSMVAYEVSNKLVDMDHRSHPRHPHSGCRTVLRLHRALHWLQLFLDGLRTSSEDARTSTLC
SEAYNATLANYHSWIVRQAVTVAFCALPSRKVFLEAMNMESTEQAVEMLGEALPFIEHVYDISQKLYAEH
SLLDLP

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_024472
ORF Size 648 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024472.1
RefSeq Size 2662 bp
RefSeq ORF 651 bp
Locus ID 79554
UniProt ID Q8BS40
Cytogenetics 4 87.66 cM
MW 24.6 kDa
Summary Mediates the intracellular transfer of ceramide-1-phosphate (C1P) between organelle membranes and the cell membrane. Required for normal structure of the Golgi stacks. Can bind phosphoceramides with a variety of aliphatic chains, but has a preference for lipids with saturated C16:0 or monounsaturated C18:1 aliphatic chains, and is inefficient with phosphoceramides containing lignoceryl (C24:0). Plays a role in the regulation of the cellular levels of ceramide-1-phosphate, and thereby contributes to the regulation of phospholipase PLA2G4A activity and the release of arachidonic acid. Has no activity with galactosylceramide, lactosylceramide, sphingomyelin, phosphatidylcholine, phosphatidic acid and ceramide. C1P transfer is stimulated by phosphatidylserine in C1P source vesicles (By similarity). Regulates autophagy, inflammasome mediated IL1B and IL18 processing, and pyroptosis, but not apoptosis (PubMed:29164996).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_024472" in other vectors (4)
SKU Description Size Price
MC200085 Gltpd1 (untagged) - Mouse glycolipid transfer protein domain containing 1 (Gltpd1), (10ug) 10 ug
$300.00
MG202392 Gltpd1 (tGFP-tagged) - Mouse cDNA sequence BC002216 (BC002216) 10 ug
$500.00
MR202392L3 Lenti ORF clone of Gltpd1 (Myc-DDK-tagged) - Mouse glycolipid transfer protein domain containing 1 (Gltpd1) 10 ug
$600.00
MR202392L4 Lenti ORF clone of Gltpd1 (mGFP-tagged) - Mouse glycolipid transfer protein domain containing 1 (Gltpd1) 10 ug
$600.00

Plasmid Map for MR202392

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR202392
Circular map for MR202392

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products