OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Arl8a (NM_026823) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR201740
Arl8a (Myc-DDK-tagged) - Mouse ADP-ribosylation factor-like 8A (Arl8a)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Arl8a or NM_026823"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Arl8a
Synonyms 1110033P22Rik; Arl10b; gie2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201740 representing NM_026823
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCGCTTTGTTCAACAAGCTGCTGGACTGGTTCAAGGCCCTGTTCTGGAAGGAGGAAATGGAGCTCA
CGCTGGTGGGGCTGCAGTACTCGGGCAAGACCACCTTCGTCAACGTGATCGCGTCAGGACAGTTCAATGA
GGACATGATCCCCACTGTGGGTTTCAACATGCGAAAAATCACCAAAGGGAATGTGACCATCAAGCTCTGG
GACATTGGGGGGCAGCCCCGTTTCCGAAGCATGTGGGAACGCTACTGCAGAGGAGTGAGCGCCATTGTGT
ATATGGTGGATGCTGCGGATCAGGAGAAGATCGAGGCCTCCAAGAATGAGCTCCACAACCTGCTAGACAA
GCCACAGCTACAAGGCATCCCGGTCTTAGTCCTTGGTAACAAGCGAGACCTCGCCGGAGCGCTAGATGAG
AAGGAGCTAATCGAGAAAATGAACCTGTCTGCTATCCAGGACCGAGAGATCTGCTGCTACTCCATATCCT
GCAAAGAGAAGGACAACATAGACATCACCCTACAGTGGCTTATTCAACACTCAAAGTCACGGAGAAGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201740 representing NM_026823
Red=Cloning site Green=Tags(s)

MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLW
DIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLAGALDE
KELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_026823
ORF Size 558 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026823.2, NP_081099.1
RefSeq Size 1702 bp
RefSeq ORF 561 bp
Locus ID 68724
UniProt ID Q8VEH3
Cytogenetics 1 E4
MW 21.8 kDa
Summary Plays a role in lysosomes motility (PubMed:30174114). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (PubMed:30174114). May play a role in chromosome segregation (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_026823" in other vectors (4)
SKU Description Size Price
MC201644 Arl8a (untagged) - Mouse ADP-ribosylation factor-like 8A (Arl8a), (10ug) 10 ug
$300.00
MG201740 Arl8a (tGFP-tagged) - Mouse ADP-ribosylation factor-like 8A (Arl8a) 10 ug
$500.00
MR201740L3 Lenti ORF clone of Arl8a (Myc-DDK-tagged) - Mouse ADP-ribosylation factor-like 8A (Arl8a) 10 ug
$600.00
MR201740L4 Lenti ORF clone of Arl8a (mGFP-tagged) - Mouse ADP-ribosylation factor-like 8A (Arl8a) 10 ug
$600.00

Plasmid Map for MR201740

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR201740
Circular map for MR201740

file-alt Citations

The molecular appearance of native TRPM7 channel complexes identified by high-resolution proteomics
Kollewe, Chubanov, Tseung et al
Elife (2021) 10 DOI: 10.7554/eLife.68544
AI Summary: OriGene products, specifically the pCMV6-Entry expression vectors encoding Cnnm1 (MR218318), Cnnm2 (MR218370), and Cnnm3 (MR224758), were used to express these proteins in heterologous reconstitution experiments to study the composition and function of native TRPM7 channel complexes.
Snippet: and Arl8A cDNAs in the pCMV6-Entry expression vector were acquired from OriGene (MR218318 for Cnnm1, MR218370 for Cnnm2, MR224758 for Cnnm3,
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products