OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Jagn1 (NM_026365) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR201675
Jagn1 (Myc-DDK-tagged) - Mouse jagunal homolog 1 (Drosophila) (Jagn1), transcript variant 1
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Jagn1 or NM_026365"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Jagn1
Synonyms 5830427H10Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201675 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCTCGGGCAGGCCCGCGAGCGGCCGGCACCGACGGCAGCGACTTTCAGCACCGGGAGCGCGTCG
CCATGCACTACCAGATGAGTGTGACCCTCAAGTACGAAATCAAGAAGCTGATCTACGTGCATCTCGTCAT
ATGGCTGCTGTTGGTGGCCAAGATGAGCGTGGGACACCTGAGGCTCTTGTCACATGATCAGGTGGCCATG
CCCTATCAGTGGGAATATCCGTATTTGTTGAGCATTGTGCCCTCTGTCTTGGGCCTGCTCTCCTTCCCTC
GGAACAACATTAGCTACCTGGTGCTCTCCATGATCAGCATGGGGCTCTTCTCCATCGCTCCCCTCATTTA
TGGCAGCATGGAGATGTTCCCTGCGGCACAGCAACTCTACCGCCATGGCAAGGCCTATCGCTTCCTGTTT
GGTTTTTCTGCTGTCTCTGTCATGTACCTGGTGTTGGTACTGGCAGTCCAAGTTCATGCCTGGCAACTGT
ACTACAGCAAAAAACTCTTAGACTCTTGGTTCACCAGCACACAGGAGAAGAAACGGAAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201675 protein sequence
Red=Cloning site Green=Tags(s)

MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAM
PYQWEYPYLLSIVPSVLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLF
GFSAVSVMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKRK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_026365
ORF Size 549 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026365.3
RefSeq Size 1218 bp
RefSeq ORF 552 bp
Locus ID 67767
UniProt ID Q5XKN4
Cytogenetics 6 E3
MW 21.1 kDa
Summary Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function. Required for vesicle-mediated transport; it is however unclear whether it is involved in early secretory pathway or intracellular protein transport. Acts as a regulator of neutrophil function, probably via its role in vesicle-mediated transport: required for defense against fungal pathogens and for granulocyte colony-stimulating factor (GM-CSF) signaling pathway; possibly by regulating glycosylation and/or targeting of proteins contributing to the viability and migration of neutrophils.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_026365" in other vectors (4)
SKU Description Size Price
MC203268 Jagn1 (untagged) - Mouse jagunal homolog 1 (Drosophila) (Jagn1), transcript variant 1, (10ug) 10 ug
$300.00
MG201675 Jagn1 (tGFP-tagged) - Mouse jagunal homolog 1 (Drosophila) (Jagn1) 10 ug
$500.00
MR201675L3 Lenti ORF clone of Jagn1 (Myc-DDK-tagged) - Mouse jagunal homolog 1 (Drosophila) (Jagn1), transcript variant 1 10 ug
$600.00
MR201675L4 Lenti ORF clone of Jagn1 (mGFP-tagged) - Mouse jagunal homolog 1 (Drosophila) (Jagn1), transcript variant 1 10 ug
$600.00

Plasmid Map for MR201675

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR201675
Circular map for MR201675

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products