OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cd3g (NM_009850) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR201641
Cd3g (Myc-DDK-tagged) - Mouse CD3 antigen, gamma polypeptide (Cd3g)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Cd3g or NM_009850"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cd3g
Synonyms Ctg-3; Ctg3; T3g
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201641 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCAGAGGAAGGGTCTGGCTGGCCTCTTCCTGGTGATCTCTCTTCTTCAAGGCACTGTAGCCCAGA
CAAATAAAGCAAAGAATTTGGTACAAGTGGATGGCAGCCGAGGAGACGGTTCTGTACTTCTGACTTGTGG
CTTGACTGACAAGACTATCAAGTGGCTTAAAGACGGGAGCATAATAAGTCCTCTAAATGCAACTAAAAAC
ACATGGAATCTGGGCAACAATGCCAAAGACCCTCGAGGCACGTATCAGTGTCAAGGAGCAAAGGAGACAT
CAAACCCCCTGCAAGTGTATTACAGAATGTGTGAAAACTGCATTGAGCTAAACATAGGCACCATATCCGG
CTTTATCTTCGCTGAGGTCATCAGCATCTTCTTCCTTGCTCTTGGTGTATATCTCATTGCGGGACAGGAT
GGAGTTCGCCAGTCAAGAGCTTCAGACAAGCAGACTCTGTTGCAAAATGAACAGCTGTACCAGCCCCTCA
AGGACCGGGAATATGACCAGTACAGCCATCTCCAAGGAAACCAACTGAGGAAGAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201641 protein sequence
Red=Cloning site Green=Tags(s)

MEQRKGLAGLFLVISLLQGTVAQTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKN
TWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTISGFIFAEVISIFFLALGVYLIAGQD
GVRQSRASDKQTLLQNEQLYQPLKDREYDQYSHLQGNQLRKK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_009850
ORF Size 546 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009850.2
RefSeq Size 1023 bp
RefSeq ORF 549 bp
Locus ID 12502
UniProt ID Q3U4Y3, P11942
Cytogenetics 9 24.84 cM
MW 20.2 kDa
Summary Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G (PubMed:25920998).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_009850" in other vectors (4)
SKU Description Size Price
MC201401 Cd3g (untagged) - Mouse CD3 antigen, gamma polypeptide (Cd3g), (10ug) 10 ug
$300.00
MG201641 Cd3g (tGFP-tagged) - Mouse CD3 antigen, gamma polypeptide (Cd3g) 10 ug
$500.00
MR201641L3 Lenti ORF clone of Cd3g (Myc-DDK-tagged) - Mouse CD3 antigen, gamma polypeptide (Cd3g) 10 ug
$600.00
MR201641L4 Lenti ORF clone of Cd3g (mGFP-tagged) - Mouse CD3 antigen, gamma polypeptide (Cd3g) 10 ug
$600.00

Plasmid Map for MR201641

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR201641
Circular map for MR201641

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products