OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Calca (NM_001033954) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR200706
Calca (Myc-DDK-tagged) - Mouse calcitonin/calcitonin-related polypeptide, alpha (Calca), transcript variant 2
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $289.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA364397 Calcitonin gene-related peptide 1 (alpha-CGRP), guinea pig anti canine/mouse/rat, polyclonal.
50 ul
$855.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Calca or NM_001033954"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Calca
Synonyms C; CA; Calc; Calc1; Cg; Cgrp; CGRP-1; CGRP1; Ct; Ctn
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200706 representing NM_001033954.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGGCTTCCTGAAGTTCTCCCCTTTCCTGGTTGTCAGCATCTTGCTCCTGTACCAGGCATGCAGCCTC
CAGGCAGTGCCTTTGAGGTCAATCTTGGAAAGCAGCCCAGGCATGGCCACTCTCAGTGAAGAAGAAGTT
CGCCTGCTGGCTGCACTGGTGCAGGACTATATGCAGATGAAAGCCAGGGAGCTGGAGCAGGAGGAAGAG
CAGGAGGCTGAGGGCTCTAGTGTCACTGCTCAGAAGAGATCCTGCAACACTGCCACCTGTGTGACCCAT
CGGCTGGCAGGTCTGCTGAGCAGATCAGGAGGTGTGGTGAAGGACAACTTTGTTCCCACCAATGTGGGC
TCTGAAGCCTTCGGCCGCCGCCGCAGGGACCTTCAGGCC
ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAGGTTTAAACGGCCGGC
Protein Sequence
>Peptide sequence encoded by MR200706
Blue=ORF Red=Cloning site Green=Tag(s)

MGFLKFSPFLVVSILLLYQACSLQAVPLRSILESSPGMATLSEEEVRLLAALVQDYMQMKARELEQEEE
QEAEGSSVTAQKRSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAFGRRRRDLQA
myc-FLAG tag

Recombinant protein using MR200706 also available, TP500706
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001033954
ORF Size 384 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001033954.3
RefSeq Size 1022 bp
RefSeq ORF 387 bp
Locus ID 12310
UniProt ID Q99JA0
Cytogenetics 7 59.99 cM
MW 14.1 kDa
Summary This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide (CGRP) and katacalcin. Alternative splicing of the mRNA results in multiple variants that encode either calcitonin or CGRP preproproteins. Post-translational processing of the calcitonin and CGRP propeptides results in either calcitonin and katacalcin, or CGRP, respectively. Calcitonin and katacalcin modulate calcium levels in the blood stream. CGRP can function as a vasodilator and play a role in the transmission of pain. The human homolog of CGRP was found to have antimicrobial activity. provided by RefSeq, Mar 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001033954" in other vectors (3)
SKU Description Size Price
MG200706 Calca (tGFP-tagged) - Mouse calcitonin/calcitonin-related polypeptide, alpha (Calca), transcript variant 2 10 ug
$350.00
MR200706L3 Lenti ORF clone of Calca (Myc-DDK-tagged) - Mouse calcitonin/calcitonin-related polypeptide, alpha (Calca), transcript variant 2 10 ug
$450.00
MR200706L4 Lenti ORF clone of Calca (mGFP-tagged) - Mouse calcitonin/calcitonin-related polypeptide, alpha (Calca), transcript variant 2 10 ug
$450.00

Plasmid Map for MR200706

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR200706
Circular map for MR200706

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products