OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Supt4b (NM_011509) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR200514
Gm3258 (Myc-DDK-tagged) - Mouse predicted gene 3258 (Gm3258)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $289.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Supt4b or NM_011509"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Supt4b
Synonyms 100041294; Gm3258; Supt4h1b; Supt4h2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200514 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCTGGAGACGGTACCAAAGGACCTGCGGCATCTGCGGGCTTGTTTGCTGTGCTCGTTAGTCAAGA
CTATAGACCAGTTCGAATATGATGGGTGTGACAATTGCGATGCATACCTACAAATGAAGGGCAACAGAGA
GATGGTTTATGACTGCACCAGCTCTTCATTTGATGGAATCATTGCGATGATGAGTCCAGAGGACAGCTGG
GTCTCCAAGTGGCAGCGAGTCAGTAACTTTAAGCCAGGTGTATATGCTGTGTCCGTCACTGGTCGCCTGC
CCCAAGGAATCGTGCGGGAGCTGAAAAGTCGAGGAGTGGCCTACAAATCCAGAGACACAGCAATAAAGAC
C

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR200514 protein sequence
Red=Cloning site Green=Tags(s)

MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSW
VSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_011509
ORF Size 351 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011509.1, NM_011509.2, NP_035639.1
RefSeq Size 710 bp
RefSeq ORF 354 bp
Locus ID 100041294
UniProt ID Q9Z199
Cytogenetics 10 17.4 cM
MW 13.2 kDa
Summary Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_011509" in other vectors (6)
SKU Description Size Price
MC201807 Gm3258 (untagged) - Mouse predicted gene 3258 (Gm3258), (10ug) 10 ug
$150.00
MC201808 Gm3258 (untagged) - Mouse predicted gene 3258 (Gm3258), (10ug) 10 ug
$150.00
MC207986 Gm3258 (untagged) - Mouse predicted gene 3258 (Gm3258), (10ug) 10 ug
$165.00
MG200514 Gm3258 (tGFP-tagged) - Mouse suppressor of Ty 4 homolog 2 (S. cerevisiae) (Supt4h2) 10 ug
$489.00
MR200514L3 Lenti ORF clone of Gm3258 (Myc-DDK-tagged) - Mouse predicted gene 3258 (Gm3258) 10 ug
$450.00
MR200514L4 Lenti ORF clone of Gm3258 (mGFP-tagged) - Mouse predicted gene 3258 (Gm3258) 10 ug
$450.00

Plasmid Map for MR200514

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR200514
Circular map for MR200514

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products