OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Aicda (NM_009645) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG227286
Aicda (tGFP-tagged) - Mouse activation-induced cytidine deaminase (Aicda), (10ug)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
  $650.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Aicda or NM_009645"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Aicda
Synonyms Aid; Arp2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG227286 representing NM_009645
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAGCCTTCTGATGAAGCAAAAGAAGTTTCTTTACCATTTCAAAAATGTCCGCTGGGCCAAGGGAC
GGCATGAGACCTACCTCTGCTACGTGGTGAAGAGGAGAGATAGTGCCACCTCCTGCTCACTGGACTTCGG
CCACCTTCGCAACAAGTCTGGCTGCCACGTGGAATTGTTGTTCCTACGCTACATCTCAGACTGGGACCTG
GACCCGGGCCGGTGTTACCGCGTCACCTGGTTCACCTCCTGGAGCCCGTGCTATGACTGTGCCCGGCACG
TGGCTGAGTTTCTGAGATGGAACCCTAACCTCAGCCTGAGGATTTTCACCGCGCGCCTCTACTTCTGTGA
AGACCGCAAGGCTGAGCCTGAGGGGCTGCGGAGACTGCACCGCGCTGGGGTCCAGATCGGGATCATGACC
TTCAAAGACTATTTTTACTGCTGGAATACATTTGTAGAAAATCGTGAAAGAACTTTCAAAGCCTGGGAAG
GGCTACATGAAAATTCTGTCCGGCTAACCAGACAACTTCGGCGCATCCTTTTGCCCTTGTACGAAGTCGA
TGACTTGCGAGATGCATTTCGTATGTTGGGATTT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227286 representing NM_009645
Red=Cloning site Green=Tags(s)

MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDL
DPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMT
FKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

TRTRPLE - GFP Tag - V
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_009645
ORF Size 594 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009645.2, NP_033775.1
RefSeq Size 2413 bp
RefSeq ORF 597 bp
Locus ID 11628
UniProt ID Q9WVE0
Cytogenetics 6 F1
Summary Single-stranded DNA-specific cytidine deaminase. Involved in somatic hypermutation (SHM), gene conversion, and class-switch recombination (CSR) in B-lymphocytes by deaminating C to U during transcription of Ig-variable (V) and Ig-switch (S) region DNA. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_009645" in other vectors (4)
SKU Description Size Price
MC208119 Aicda (untagged) - Mouse activation-induced cytidine deaminase (Aicda), (10ug) 10 ug
$450.00
MR227286 Aicda (Myc-DDK-tagged) - Mouse activation-induced cytidine deaminase (Aicda) 10 ug
$450.00
MR227286L3 Lenti ORF clone of Aicda (Myc-DDK-tagged) - Mouse activation-induced cytidine deaminase (Aicda) 10 ug
$750.00
MR227286L4 Lenti ORF clone of Aicda (mGFP-tagged) - Mouse activation-induced cytidine deaminase (Aicda) 10 ug
$750.00

Plasmid Map for MG227286

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MG227286
Circular map for MG227286

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products