OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Jun (NM_010591) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG227043
Jun (tGFP-tagged) - Mouse Jun oncogene (Jun), (10ug)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
$489.00 $657.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Jun or NM_010591"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Jun
Synonyms AP-1; c-jun; Junc
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG227043 representing NM_010591
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGCAAAGATGGAAACGACCTTCTACGACGATGCCCTCAACGCCTCGTTCCTCCAGTCCGAGAGCG
GTGCCTACGGCTACAGTAACCCTAAGATCCTAAAACAGAGCATGACCTTGAACCTGGCCGACCCGGTGGG
CAGTCTGAAGCCGCACCTCCGCGCCAAGAACTCGGACCTTCTCACGTCGCCCGACGTCGGGCTGCTCAAG
CTGGCGTCGCCGGAGCTGGAGCGCCTGATCATCCAGTCCAGCAATGGGCACATCACCACTACACCGACCC
CCACCCAGTTCTTGTGCCCCAAGAACGTGACCGACGAGCAGGAGGGCTTCGCCGAGGGCTTCGTGCGCGC
CCTGGCTGAACTGCATAGCCAGAACACGCTTCCCAGTGTCACCTCCGCGGCACAGCCGGTCAGCGGGGCG
GGCATGGTGGCTCCCGCGGTGGCCTCAGTAGCAGGCGCTGGCGGCGGTGGTGGCTACAGCGCCAGCCTGC
ACAGTGAGCCTCCGGTCTACGCCAACCTCAGCAACTTCAACCCGGGTGCGCTGAGCAGCGGCGGTGGGGC
GCCCTCCTATGGCGCGGCCGGGCTGGCCTTTCCCTCGCAGCCGCAGCAGCAGCAGCAGCCGCCTCAGCCG
CCGCACCACTTGCCCCAACAGATCCCGGTGCAGCACCCGCGGCTGCAAGCCCTGAAGGAAGAGCCGCAGA
CCGTGCCGGAGATGCCGGGAGAGACGCCGCCCCTGTCCCCTATCGACATGGAGTCTCAGGAGCGGATCAA
GGCAGAGAGGAAGCGCATGAGGAACCGCATTGCCGCCTCCAAGTGCCGGAAAAGGAAGCTGGAGCGGATC
GCTCGGCTAGAGGAAAAAGTGAAAACCTTGAAAGCGCAAAACTCCGAGCTGGCATCCACGGCCAACATGC
TCAGGGAACAGGTGGCACAGCTTAAGCAGAAAGTCATGAACCACGTTAACAGTGGGTGCCAACTCATGCT
AACGCAGCAGTTGCAAACGTTT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227043 representing NM_010591
Red=Cloning site Green=Tags(s)

MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK
LASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVSGA
GMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPSQPQQQQQPPQP
PHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERI
ARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_010591
ORF Size 1002 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010591.2, NP_034721.1
RefSeq Size 3187 bp
RefSeq ORF 1005 bp
Locus ID 16476
UniProt ID P05627
Cytogenetics 4 43.34 cM
Summary Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGACGTCA-3' (PubMed:14707112). Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation (PubMed:17210646). Involved in activated KRAS-mediated transcriptional activation of USP28 (By similarity). Binds to the USP28 promoter (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_010591" in other vectors (6)
SKU Description Size Price
MC208799 Jun (untagged) - Mouse Jun oncogene (Jun), (10ug) 10 ug
$457.00
MR227043 Jun (Myc-DDK-tagged) - Mouse Jun oncogene (Jun) 10 ug
$289.00 $457.00
MR227043L1 Lenti ORF clone of Jun (Myc-DDK-tagged) - Mouse Jun oncogene (Jun) 10 ug
$757.00
MR227043L2 Lenti ORF clone of Jun (mGFP-tagged) - Mouse Jun oncogene (Jun) 10 ug
$757.00
MR227043L3 Lenti ORF clone of Jun (Myc-DDK-tagged) - Mouse Jun oncogene (Jun) 10 ug
$757.00
MR227043L4 Lenti ORF clone of Jun (mGFP-tagged) - Mouse Jun oncogene (Jun) 10 ug
$757.00

Plasmid Map for MG227043

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MG227043
Circular map for MG227043

file-alt Citations

Erk1/2 Inactivation-Induced c-Jun Degradation Is Regulated by Protein Phosphatases, UBE2d3, and the C-Terminus of c-Jun
Ouyang, Frucht
Int J Mol Sci (2021) 22 (8) DOI: 10.3390/ijms22083889
Cited by 5
AI Summary: In this study, OriGene products including c-Jun shRNA (OriGene, #TF314524) and UBE2d3 shRNA (OriGene, #TF311073) were used for gene knockdown experiments to investigate the roles of c-Jun and UBE2d3 in the regulation of c-Jun degradation upon Erk1/2 inactivation.
FigureFigureFigure
Targeting EP4 downstream c-Jun through ERK1/2-mediated reduction of DNMT1 reveals novel mechanism of solamargine-inhibited growth of lung cancer cells
Chen, Tang, Xiao et al
J. Cell. Mol. Med. (2016)
Cited by 40
AI Summary: OriGene products, specifically the pCMV6-AC-DNMT1, pCMV6-AC-c-Jun, and pCMV6-AC-EP4 overexpression constructs, were used in this study to investigate the roles of DNMT1, c-Jun, and EP4 in solamargine’s inhibition of lung cancer cell growth.
Snippet: Transient transfection assay. This procedure was reported previously [12]. The control or EP4, DNMT1 and c-Jun overexpression constructs (pCMV6-AC-DNMT1, pCMV6-AC-c-Jun, pCMV6-AC-EP4) were obtained from OriGene Technologies, Inc. (Rockville, ... Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products