OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cldn19 (NM_001038590) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG225217
Cldn19 (tGFP-tagged) - Mouse claudin 19 (Cldn19) transcript variant 1, (10ug)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Cldn19 or NM_001038590"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cldn19
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG225217 representing NM_001038590
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAACTCGGGCCTCCAGCTCCTGGGCTACTTCCTAGCCTTGGGCGGCTGGGTGGGCATCATCGCCA
GCACTGCCCTGCCACAGTGGAAGCAGTCTTCCTATGCAGGCGATGCCATCATCACTGCCGTGGGCCTCTA
CGAAGGGCTGTGGATGTCTTGCGCCTCTCAGAGCACCGGGCAGGTGCAATGCAAACTCTACGATTCACTC
CTGGCCCTGGACGGTCATATCCAGTCAGCACGAGCCCTGATGGTCGTGGCTGTGCTCCTGGGCTTTGTGG
CCATGGTGCTCAGTGTCGTGGGCATGAAGTGCACTCGGGTTGGAGACAGTAACCCCACTGCCAAGAGCCG
TGTGGCCATCTCCGGAGGTGCTCTCTTCCTCTTGGCAGGTCTCTGTACTTTGACTGCTGTCTCCTGGTAT
GCTACCCTGGTAACACAGGAATTCTTCAACCCCAGCACTCCTGTCAATGCCAGGTACGAATTTGGCCCAG
CTCTGTTCGTCGGCTGGGCCTCGGCCGGCCTGGCCATGCTGGGCGGTTCCTTTCTCTGCTGCACATGCCC
AGAGCCGGAGAGGGCGAACAGCATCCCACAGCCCTATCGCTCTGGACCCTCAACTGCTGCCAGAGAACCT
GTTGTTAAGTTGCCCGCCTCGGTCAAGGGCCCCCTGGGTGTG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG225217 representing NM_001038590
Red=Cloning site Green=Tags(s)

MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSL
LALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKSRVAISGGALFLLAGLCTLTAVSWY
ATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAMLGGSFLCCTCPEPERANSIPQPYRSGPSTAAREP
VVKLPASVKGPLGV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001038590
ORF Size 672 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001038590.1, NP_001033679.1
RefSeq Size 888 bp
RefSeq ORF 675 bp
Locus ID 242653
UniProt ID Q9ET38
Cytogenetics 4 D2.1
Summary This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. siRNA knockdown of this gene in mice develops the FHHNC (familial hypomagnesemia with hypercalciuria and nephrocalcinosis) symptoms of chronic renal wasting of magnesium and calcium together with defective renal salt handling. The protein encoded by this gene interacts with another family member, Claudin 16, and their interaction is required for their assembly into tight junctions and for renal reabsorption of magnesium. This protein is a constituent of tight junctions in the Schwann cells of peripheral myelinated nerves and the gene deficiency affects the nerve conduction of peripheral myelinated fibers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Aug 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001038590" in other vectors (4)
SKU Description Size Price
MC213151 Cldn19 (untagged) - Mouse claudin 19 (Cldn19), transcript variant 1, (10ug) 10 ug
$330.00
MR225217 Cldn19 (Myc-DDK-tagged) - Mouse claudin 19 (Cldn19), transcript variant 1 10 ug
$289.00 $300.00
MR225217L3 Lenti ORF clone of Cldn19 (Myc-DDK-tagged) - Mouse claudin 19 (Cldn19), transcript variant 1 10 ug
$600.00
MR225217L4 Lenti ORF clone of Cldn19 (mGFP-tagged) - Mouse claudin 19 (Cldn19), transcript variant 1 10 ug
$600.00

Plasmid Map for MG225217

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MG225217
Circular map for MG225217

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products