OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cited4 (NM_019563) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG223376
Cited4 (tGFP-tagged) - Mouse Cbp/p300-interacting transactivator with Glu/Asp-rich carboxy-terminal domain 4 (Cited4), (10ug)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA342331 Rabbit Polyclonal Anti-Cited4 Antibody
100 ul
$585.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Cited4 or NM_019563"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cited4
Synonyms MRG-2; Mrg2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG223376 representing NM_019563
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGACCACCTGATGCTCGCCGAGGGCTACTGCCTGCTACAGGTGCCGCCGCACACCCACGGCCCGC
ACGCTCCCCGGACTCTGCAGCCATACGCAGGCCCGGGCATGGACAGCGGTCTGCGGCCGCGGGGGGCTCC
GCTGGGACCGCCGCCGCCACCCGGGACCCTGGCATACGGCTCCTTCGGGTCGCCGGTCTCTTTCCAGCCC
TTCCCCGTCTCGCAGTCGCCGGGCGCCGGTAGCACGCACCTGCAGTCTGCAGCCACACCGTCCCCGGGCC
GCATCCCGGCGCCCCCGGCAGCCGCTGGAGGGCCCTCACCTCTGCAGCCGGCGCCCGGAGCCGCAGCCTC
GTTGCCGCCGCCGCCGCCGCCACCCGCCCTGGGCTGCATGGACACCGAGCTCATCGACGAAGAGGCGCTG
ACGTCGCTGGAACTCGAGCTCGGGTTGCACCGCGTACGCGAGCTGCCGGAGCTCTTCCTCGGCCAGAGCG
AGTTCGATTGCTTCTCAGACCTGGGGTCAGCGCCGGCCGCCGGCTCGGTGAGCTGT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG223376 representing NM_019563
Red=Cloning site Green=Tags(s)

MADHLMLAEGYCLLQVPPHTHGPHAPRTLQPYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQP
FPVSQSPGAGSTHLQSAATPSPGRIPAPPAAAGGPSPLQPAPGAAASLPPPPPPPALGCMDTELIDEEAL
TSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPAAGSVSC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_019563
ORF Size 546 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019563.2, NP_062509.1
RefSeq Size 1258 bp
RefSeq ORF 549 bp
Locus ID 56222
UniProt ID Q9WUL8
Cytogenetics 4 56.52 cM
Summary Acts as transcriptional coactivator for TFAP2/AP-2. Enhances estrogen-dependent transactivation mediated by estrogen receptors. May function as an inhibitor of transactivation by HIF1A by disrupting HIF1A interaction with CREBBP. May be involved in regulation of gene expression during development and differentiation of blood cells, endothelial cells and mammary epithelial cells.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_019563" in other vectors (4)
SKU Description Size Price
MC210030 Cited4 (untagged) - Mouse Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4 (Cited4), (10ug) 10 ug
$330.00
MR223376 Cited4 (Myc-DDK-tagged) - Mouse Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4 (Cited4) 10 ug
$289.00 $300.00
MR223376L3 Lenti ORF clone of Cited4 (Myc-DDK-tagged) - Mouse Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4 (Cited4) 10 ug
$600.00
MR223376L4 Lenti ORF clone of Cited4 (mGFP-tagged) - Mouse Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4 (Cited4) 10 ug
$600.00

Plasmid Map for MG223376

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MG223376
Circular map for MG223376

file-alt Citations

Transcriptional dysregulation in developing trigeminal sensory neurons in the LgDel mouse model of DiGeorge 22q11.2 Deletion Syndrome
Maynard, Horvath, P Bernot et al
Hum. Mol. Genet. (2020) 29 (6), 1002-1017 DOI: 10.1093/hmg/ddaa024
Cited by 8
AI Summary: OriGene plasmids containing the full-length Tbx2 or d4 open reading frame sequences were used to generate probes for whole-mount in situ hybridization, enabling the authors to assess gene expression differences in trigeminal sensory neurons of LgDel and wild-type mouse embryos.
Snippet: using plasmids containing the full-length Tbx2 or d4 open reading frame sequences (Origene). Whole-mount ISH was performed using E10.5 WT and LgDel embryos fixed in 4% paraformaldehyde overnight and stored in 100% methanol. Embryos were re-hydrated into PBS + Tween 20 buffer before probe hybridization overnight at 65°C. After several washes, embryos were incubated in 10% sheep serum in TBS + Tween...
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products