OriGene Logo

Rab43 (NM_001039394) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG216803
Rab43 (tGFP-tagged) - Mouse RAB43 member RAS oncogene family (Rab43) transcript variant 1, (10ug)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Rab43 or NM_001039394"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rab43
Synonyms 1810048P08Rik; 2500004H21Rik; AW490415
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG216803 representing NM_001039394
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGCCCTGGCCCGGGAGATCAGGACGAACACTACGATTTCCTGTTCAAGCTGGTGTTAGTGGGCG
ACGCGAGCGTGGGCAAGACGTGCGTGGTGCAGCGCTTCAAGACCGGCGCCTTCTCGGCGCGTCAGGGCAG
CACCATCGGTGTCGACTTCACCATGAAGACGCTGGAGATCCAGGGCAAGCGGGTCAAGTTACAGATTTGG
GACACAGCTGGCCAGGAGCGGTTCCGGACCATCACCCAGAGCTACTACCGAAGTGCCAATGGGGCTATCC
TTGCGTACGACATCAGCAAGAGGAGCACCTTCTTGTCAGTGCCTCACTGGATCGAGGATGTGAGGAAGTA
CGCGGGTTCCAACATCGTGCAGCTGCTGATTGGGAACAAGTCAGACCTTGCCGATTTCCGGGAGGTCCCA
TTGGCGGAGGCACAGAGCCTGGCTGAGCACTATGACATCCTCTGTGCCATCGAGACCTCCGCAAAGGACT
CCAGCAATGTGGAGGAGGCCTTCACCAGAGTGGCCACGGAGCTCATCATGAGGCACGGAGGTCCCATGTT
CAGTGAGAAGAACACAGACCACATCCAGCTGGACAGCAAGGACATTGCGGAGAGCTGGGGCTGTGGGTGC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG216803 representing NM_001039394
Red=Cloning site Green=Tags(s)

MAGPGPGDQDEHYDFLFKLVLVGDASVGKTCVVQRFKTGAFSARQGSTIGVDFTMKTLEIQGKRVKLQIW
DTAGQERFRTITQSYYRSANGAILAYDISKRSTFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLADFREVP
LAEAQSLAEHYDILCAIETSAKDSSNVEEAFTRVATELIMRHGGPMFSEKNTDHIQLDSKDIAESWGCGC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001039394
ORF Size 630 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001039394.1, NP_001034483.1
RefSeq Size 4605 bp
RefSeq ORF 633 bp
Locus ID 69834
UniProt ID Q8CG50
Cytogenetics 6 D1
Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. The low intrinsic GTPase activity of RAB43 is activated by USP6NL. Involved in retrograde transport from the endocytic pathway to the Golgi apparatus. Involved in the transport of Shiga toxin from early and recycling endosomes to the trans-Golgi network. Required for the structural integrity of the Golgi complex. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and Mycobacterium.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_001039394" in other vectors (4)
SKU Description Size Price
MC211013 Rab43 (untagged) - Mouse RAB43, member RAS oncogene family (Rab43), transcript variant 1, (10ug) 10 ug
$330.00
MR216803 Rab43 (Myc-DDK-tagged) - Mouse RAB43, member RAS oncogene family (Rab43), transcript variant 1 10 ug
$289.00 $300.00
MR216803L3 Lenti ORF clone of Rab43 (Myc-DDK-tagged) - Mouse RAB43, member RAS oncogene family (Rab43), transcript variant 1 10 ug
$600.00
MR216803L4 Lenti ORF clone of Rab43 (mGFP-tagged) - Mouse RAB43, member RAS oncogene family (Rab43), transcript variant 1 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.